BLASTX nr result
ID: Zingiber24_contig00016063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00016063 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603637.1| Monoglyceride lipase [Medicago truncatula] g... 45 2e-08 gb|ESW09230.1| hypothetical protein PHAVU_009G110900g [Phaseolus... 43 9e-08 ref|XP_004148394.1| PREDICTED: monoglyceride lipase-like [Cucumi... 43 2e-07 >ref|XP_003603637.1| Monoglyceride lipase [Medicago truncatula] gi|355492685|gb|AES73888.1| Monoglyceride lipase [Medicago truncatula] Length = 407 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -1 Query: 223 C*W*TFVFVGLRRNSLFCRSWLPASGDLR 137 C W T +F G+R N+LFCRSW P GDL+ Sbjct: 92 CRWNTSIFYGVRNNALFCRSWFPVYGDLK 120 Score = 39.3 bits (90), Expect(2) = 2e-08 Identities = 24/46 (52%), Positives = 29/46 (63%) Frame = -2 Query: 138 GHGCSD*FLVEDTIKFLKKIKHEHNMCSIIPCSFFGHSTGGAIVLK 1 GHG SD + FL+KI+ E+ IPC FGHSTGGA+VLK Sbjct: 157 GHGGSDG--LHGYGAFLEKIRSENPG---IPCFLFGHSTGGAVVLK 197 >gb|ESW09230.1| hypothetical protein PHAVU_009G110900g [Phaseolus vulgaris] Length = 379 Score = 43.1 bits (100), Expect(2) = 9e-08 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 9/55 (16%) Frame = -2 Query: 138 GHGCSD*F---------LVEDTIKFLKKIKHEHNMCSIIPCSFFGHSTGGAIVLK 1 GHG SD +V DT FL+KI+ E+ IPC FGHSTGGA+VLK Sbjct: 161 GHGGSDGLHGYVPSLDHVVADTGAFLEKIRSENPG---IPCFLFGHSTGGAVVLK 212 Score = 38.5 bits (88), Expect(2) = 9e-08 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -1 Query: 217 W*TFVFVGLRRNSLFCRSWLPASGDLR 137 W T +F G+R +LFCRSW P S D++ Sbjct: 98 WSTSIFYGVRNKALFCRSWFPVSEDVK 124 >ref|XP_004148394.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus] gi|449507243|ref|XP_004162974.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus] Length = 386 Score = 43.1 bits (100), Expect(2) = 2e-07 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 9/55 (16%) Frame = -2 Query: 138 GHGCSD*F---------LVEDTIKFLKKIKHEHNMCSIIPCSFFGHSTGGAIVLK 1 GHG SD +V DT FL+KIK E+ PC FGHSTGGA+VLK Sbjct: 163 GHGGSDGLHGFVPSLDQVVADTGSFLEKIKSENPET---PCFLFGHSTGGAVVLK 214 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = -1 Query: 211 TFVFVGLRRNSLFCRSWLPASGDLR 137 T +F G++RN+LFCRSWLP +L+ Sbjct: 102 TSLFYGVKRNALFCRSWLPEPDELK 126