BLASTX nr result
ID: Zingiber24_contig00015365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00015365 (208 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650493.1| PREDICTED: phosphoglucomutase, cytoplasmic 2... 103 3e-20 ref|NP_001051066.1| Os03g0712700 [Oryza sativa Japonica Group] g... 103 3e-20 gb|EEC76059.1| hypothetical protein OsI_13262 [Oryza sativa Indi... 103 3e-20 gb|ABP96985.1| phosphoglucomutase [Bambusa oldhamii] 101 1e-19 tpg|DAA50994.1| TPA: hypothetical protein ZEAMMB73_666151 [Zea m... 100 2e-19 tpg|DAA50993.1| TPA: phosphoglucomutase, cytoplasmic 2 [Zea mays] 100 2e-19 ref|XP_002466576.1| hypothetical protein SORBIDRAFT_01g010280 [S... 100 2e-19 ref|XP_003560727.1| PREDICTED: phosphoglucomutase, cytoplasmic-l... 100 3e-19 gb|AFW67827.1| phosphoglucomutase, cytoplasmic 1 [Zea mays] 100 3e-19 gb|AFW67826.1| hypothetical protein ZEAMMB73_293543 [Zea mays] 100 3e-19 ref|NP_001105405.1| phosphoglucomutase, cytoplasmic 2 [Zea mays]... 99 6e-19 gb|ABK91060.1| putative phosphoglucomutase [Sorghum bicolor] gi|... 99 6e-19 gb|ABK91067.1| putative phosphoglucomutase [Sorghum bicolor] 99 6e-19 ref|XP_006826910.1| hypothetical protein AMTR_s00010p00159850 [A... 98 1e-18 ref|NP_001105703.1| phosphoglucomutase, cytoplasmic 1 [Zea mays]... 98 1e-18 dbj|BAK01292.1| predicted protein [Hordeum vulgare subsp. vulgare] 96 4e-18 dbj|BAJ92874.1| predicted protein [Hordeum vulgare subsp. vulgare] 96 4e-18 dbj|BAJ91066.1| predicted protein [Hordeum vulgare subsp. vulgare] 96 4e-18 emb|CAC85913.1| phosphoglucomutase [Triticum aestivum] 96 4e-18 ref|XP_004981995.1| PREDICTED: phosphoglucomutase, cytoplasmic 2... 95 8e-18 >ref|XP_006650493.1| PREDICTED: phosphoglucomutase, cytoplasmic 2-like [Oryza brachyantha] Length = 582 Score = 103 bits (256), Expect = 3e-20 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 MV+F+VT+K TTPFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPADKVK Sbjct: 1 MVLFSVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADKVK 54 >ref|NP_001051066.1| Os03g0712700 [Oryza sativa Japonica Group] gi|13324798|gb|AAK18846.1|AC082645_16 phosphoglucomutase [Oryza sativa Japonica Group] gi|17981609|gb|AAL51086.1|AF455812_1 phosphoglucomutase [Oryza sativa] gi|108710731|gb|ABF98526.1| Phosphoglucomutase, cytoplasmic 2, putative, expressed [Oryza sativa Japonica Group] gi|113549537|dbj|BAF12980.1| Os03g0712700 [Oryza sativa Japonica Group] gi|215701495|dbj|BAG92919.1| unnamed protein product [Oryza sativa Japonica Group] gi|222625672|gb|EEE59804.1| hypothetical protein OsJ_12328 [Oryza sativa Japonica Group] gi|385717672|gb|AFI71271.1| phosphoglucomutase [Oryza sativa Japonica Group] Length = 582 Score = 103 bits (256), Expect = 3e-20 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 MV+F+VT+K TTPFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPADKVK Sbjct: 1 MVLFSVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADKVK 54 >gb|EEC76059.1| hypothetical protein OsI_13262 [Oryza sativa Indica Group] Length = 577 Score = 103 bits (256), Expect = 3e-20 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 MV+F+VT+K TTPFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPADKVK Sbjct: 1 MVLFSVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADKVK 54 >gb|ABP96985.1| phosphoglucomutase [Bambusa oldhamii] Length = 584 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 MV+FTVT+K TTPFDGQKPGTSGLRKKVTVF+QP YL NFVQSTFNALPADKVK Sbjct: 1 MVLFTVTKKATTPFDGQKPGTSGLRKKVTVFQQPDYLQNFVQSTFNALPADKVK 54 >tpg|DAA50994.1| TPA: hypothetical protein ZEAMMB73_666151 [Zea mays] Length = 189 Score = 100 bits (250), Expect = 2e-19 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 166 TMVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 TM +FTVT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 65 TMGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVK 119 >tpg|DAA50993.1| TPA: phosphoglucomutase, cytoplasmic 2 [Zea mays] Length = 648 Score = 100 bits (250), Expect = 2e-19 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 166 TMVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 TM +FTVT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 65 TMGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVK 119 >ref|XP_002466576.1| hypothetical protein SORBIDRAFT_01g010280 [Sorghum bicolor] gi|241920430|gb|EER93574.1| hypothetical protein SORBIDRAFT_01g010280 [Sorghum bicolor] Length = 649 Score = 100 bits (250), Expect = 2e-19 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 166 TMVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 TM +FTVT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 66 TMGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVK 120 >ref|XP_003560727.1| PREDICTED: phosphoglucomutase, cytoplasmic-like [Brachypodium distachyon] Length = 648 Score = 100 bits (248), Expect = 3e-19 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 MV+FTV++K+T PFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 66 MVLFTVSKKDTKPFDGQKPGTSGLRKKVTVFQQPHYLANFVQSTFNALPADRVK 119 >gb|AFW67827.1| phosphoglucomutase, cytoplasmic 1 [Zea mays] Length = 650 Score = 99.8 bits (247), Expect = 3e-19 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -1 Query: 166 TMVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 TM +FTVT+K TTPFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALP D+V+ Sbjct: 67 TMGLFTVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPVDQVR 121 >gb|AFW67826.1| hypothetical protein ZEAMMB73_293543 [Zea mays] Length = 649 Score = 99.8 bits (247), Expect = 3e-19 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -1 Query: 166 TMVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 TM +FTVT+K TTPFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALP D+V+ Sbjct: 67 TMGLFTVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPVDQVR 121 >ref|NP_001105405.1| phosphoglucomutase, cytoplasmic 2 [Zea mays] gi|12585310|sp|P93805.2|PGMC2_MAIZE RecName: Full=Phosphoglucomutase, cytoplasmic 2; Short=PGM 2; AltName: Full=Glucose phosphomutase 2 gi|3294469|gb|AAC50049.1| phosphoglucomutase 2 [Zea mays] gi|224031393|gb|ACN34772.1| unknown [Zea mays] Length = 583 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 M +FTVT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 1 MGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVK 54 >gb|ABK91060.1| putative phosphoglucomutase [Sorghum bicolor] gi|118426347|gb|ABK91062.1| putative phosphoglucomutase [Sorghum bicolor] gi|118426349|gb|ABK91063.1| putative phosphoglucomutase [Sorghum bicolor] gi|118426353|gb|ABK91065.1| putative phosphoglucomutase [Sorghum bicolor] gi|118426367|gb|ABK91072.1| putative phosphoglucomutase [Sorghum bicolor] Length = 311 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 M +FTVT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 1 MGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVK 54 >gb|ABK91067.1| putative phosphoglucomutase [Sorghum bicolor] Length = 259 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 M +FTVT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 1 MGLFTVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADQVK 54 >ref|XP_006826910.1| hypothetical protein AMTR_s00010p00159850 [Amborella trichopoda] gi|548831339|gb|ERM94147.1| hypothetical protein AMTR_s00010p00159850 [Amborella trichopoda] Length = 583 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 MV+FTVTRKET+P D QKPGTSGLRKKVTVFKQP+YLHNFVQ+TFNALP ++VK Sbjct: 1 MVMFTVTRKETSPIDSQKPGTSGLRKKVTVFKQPNYLHNFVQATFNALPGEQVK 54 >ref|NP_001105703.1| phosphoglucomutase, cytoplasmic 1 [Zea mays] gi|12585309|sp|P93804.2|PGMC1_MAIZE RecName: Full=Phosphoglucomutase, cytoplasmic 1; Short=PGM 1; AltName: Full=Glucose phosphomutase 1 gi|3294467|gb|AAC50048.1| phosphoglucomutase 1 [Zea mays] gi|194690008|gb|ACF79088.1| unknown [Zea mays] gi|223948877|gb|ACN28522.1| unknown [Zea mays] Length = 583 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 163 MVVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 M +FTVT+K TTPFDGQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALP D+V+ Sbjct: 1 MGLFTVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPVDQVR 54 >dbj|BAK01292.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 581 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/53 (81%), Positives = 52/53 (98%) Frame = -1 Query: 160 VVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 +VF+VT+++TTP++GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 1 MVFSVTKRDTTPYEGQKPGTSGLRKKVTVFQQPHYLANFVQSTFNALPADQVK 53 >dbj|BAJ92874.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 642 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/53 (81%), Positives = 52/53 (98%) Frame = -1 Query: 160 VVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 +VF+VT+++TTP++GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 62 MVFSVTKRDTTPYEGQKPGTSGLRKKVTVFQQPHYLANFVQSTFNALPADQVK 114 >dbj|BAJ91066.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 581 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/53 (81%), Positives = 52/53 (98%) Frame = -1 Query: 160 VVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 +VF+VT+++TTP++GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 1 MVFSVTKRDTTPYEGQKPGTSGLRKKVTVFQQPHYLANFVQSTFNALPADQVK 53 >emb|CAC85913.1| phosphoglucomutase [Triticum aestivum] Length = 581 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -1 Query: 160 VVFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 +VF+VT+KET P++GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPAD+VK Sbjct: 1 MVFSVTKKETKPYEGQKPGTSGLRKKVTVFQQPHYLANFVQSTFNALPADQVK 53 >ref|XP_004981995.1| PREDICTED: phosphoglucomutase, cytoplasmic 2-like isoform X2 [Setaria italica] Length = 648 Score = 95.1 bits (235), Expect = 8e-18 Identities = 43/52 (82%), Positives = 50/52 (96%) Frame = -1 Query: 157 VFTVTRKETTPFDGQKPGTSGLRKKVTVFKQPHYLHNFVQSTFNALPADKVK 2 +F+VT+K TTPF+GQKPGTSGLRKKVTVF+QPHYL NFVQSTFNALPA++VK Sbjct: 67 MFSVTKKATTPFEGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPAEEVK 118