BLASTX nr result
ID: Zingiber24_contig00015083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00015083 (498 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGT97384.1| EG5651 [Manihot esculenta] 60 3e-07 gb|AGT97382.1| EG5651 [Manihot esculenta] 60 4e-07 gb|AGT97364.1| EG5651 [Manihot esculenta] gi|532525746|gb|AGT973... 59 5e-07 ref|XP_006847687.1| hypothetical protein AMTR_s00149p00052800 [A... 56 4e-06 ref|XP_002519846.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 gb|AGT97380.1| EG5651 [Manihot glaziovii] 55 7e-06 >gb|AGT97384.1| EG5651 [Manihot esculenta] Length = 80 Score = 60.1 bits (144), Expect = 3e-07 Identities = 38/77 (49%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = -1 Query: 483 MDSITSTTPVSRELARESLIAISQTPPENNLTSDVLPVNSTEVGMANQQVNSE-TDKYRS 307 MD+ + + VS EL RE LI IS PE SDV V G + + NS+ DKYRS Sbjct: 1 MDAKEAHSEVSEELTRELLIGISHLLPEKVQNSDVDEV--LNAGKSVSRTNSDGADKYRS 58 Query: 306 KLISISQCQSPDVPPSP 256 +LISIS C SPD+ PSP Sbjct: 59 ELISISYCSSPDMMPSP 75 >gb|AGT97382.1| EG5651 [Manihot esculenta] Length = 80 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/77 (49%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = -1 Query: 483 MDSITSTTPVSRELARESLIAISQTPPENNLTSDVLPVNSTEVGMANQQVNSE-TDKYRS 307 MD+ + + VS EL RE LI IS PE SDV V G + + NS+ DKYRS Sbjct: 1 MDAKEAHSEVSEELTRELLIGISYLLPEKVQNSDVDEV--LNAGKSVSRTNSDGADKYRS 58 Query: 306 KLISISQCQSPDVPPSP 256 +LISIS C SPD+ PSP Sbjct: 59 ELISISYCSSPDMMPSP 75 >gb|AGT97364.1| EG5651 [Manihot esculenta] gi|532525746|gb|AGT97365.1| EG5651 [Manihot esculenta] gi|532525748|gb|AGT97366.1| EG5651 [Manihot esculenta] gi|532525750|gb|AGT97367.1| EG5651 [Manihot esculenta] gi|532525752|gb|AGT97368.1| EG5651 [Manihot esculenta] gi|532525754|gb|AGT97369.1| EG5651 [Manihot esculenta] gi|532525756|gb|AGT97370.1| EG5651 [Manihot esculenta] gi|532525758|gb|AGT97371.1| EG5651 [Manihot esculenta] gi|532525760|gb|AGT97372.1| EG5651 [Manihot esculenta] gi|532525762|gb|AGT97373.1| EG5651 [Manihot esculenta] gi|532525764|gb|AGT97374.1| EG5651 [Manihot esculenta] gi|532525766|gb|AGT97375.1| EG5651 [Manihot esculenta] gi|532525768|gb|AGT97376.1| EG5651 [Manihot esculenta] gi|532525770|gb|AGT97377.1| EG5651 [Manihot esculenta] gi|532525772|gb|AGT97378.1| EG5651 [Manihot esculenta] gi|532525774|gb|AGT97379.1| EG5651 [Manihot esculenta] gi|532525778|gb|AGT97381.1| EG5651 [Manihot esculenta] gi|532525782|gb|AGT97383.1| EG5651 [Manihot esculenta] Length = 80 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 1/77 (1%) Frame = -1 Query: 483 MDSITSTTPVSRELARESLIAISQTPPENNLTSDVLPVNSTEVGMANQQVNSE-TDKYRS 307 MD+ + VS EL RE+LI IS PE SDV + + E ++ + NS+ DKYRS Sbjct: 1 MDAKEVHSEVSEELTRETLIGISYLLPEKVQNSDVDEILNAEKSVS--RTNSDGADKYRS 58 Query: 306 KLISISQCQSPDVPPSP 256 +LISIS C SPD+ PSP Sbjct: 59 ELISISYCPSPDMMPSP 75 >ref|XP_006847687.1| hypothetical protein AMTR_s00149p00052800 [Amborella trichopoda] gi|548850956|gb|ERN09268.1| hypothetical protein AMTR_s00149p00052800 [Amborella trichopoda] Length = 78 Score = 56.2 bits (134), Expect = 4e-06 Identities = 36/76 (47%), Positives = 47/76 (61%), Gaps = 5/76 (6%) Frame = -1 Query: 483 MDSITSTTPVSRELARESLIAISQTPPENNLT-----SDVLPVNSTEVGMANQQVNSETD 319 M++I + VS+E ARESLIAISQ P+ NLT S L +NST A + + + Sbjct: 1 METILPSAEVSQEKARESLIAISQLDPDKNLTLASDPSSKLLINST---AATDKGSGGAE 57 Query: 318 KYRSKLISISQCQSPD 271 +YR KLISIS QSP+ Sbjct: 58 EYRQKLISISYTQSPE 73 >ref|XP_002519846.1| conserved hypothetical protein [Ricinus communis] gi|223540892|gb|EEF42450.1| conserved hypothetical protein [Ricinus communis] Length = 154 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/79 (43%), Positives = 45/79 (56%) Frame = -1 Query: 483 MDSITSTTPVSRELARESLIAISQTPPENNLTSDVLPVNSTEVGMANQQVNSETDKYRSK 304 MD + S++LARESLI IS + PE T DV E+ + N D++RS+ Sbjct: 1 MDIKEACKQASQDLARESLIEISYSLPEKVQTPDV-----GEISVGEDMNNDGADRFRSE 55 Query: 303 LISISQCQSPDVPPSPAST 247 LISIS QSPD+ SP S+ Sbjct: 56 LISISYSQSPDITLSPVSS 74 >gb|AGT97380.1| EG5651 [Manihot glaziovii] Length = 80 Score = 55.5 bits (132), Expect = 7e-06 Identities = 36/77 (46%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = -1 Query: 483 MDSITSTTPVSRELARESLIAISQTPPENNLTSDVLPVNSTEVGMANQQVNSE-TDKYRS 307 MD+ + + VS EL RE LI IS PE SDV V + G + + NS+ +KYRS Sbjct: 1 MDAKEAHSEVSEELTRELLIGISYLLPEKVQNSDVDEV--LDAGKSVSRTNSDGAEKYRS 58 Query: 306 KLISISQCQSPDVPPSP 256 +LISIS C SPD+ SP Sbjct: 59 ELISISYCPSPDMMASP 75