BLASTX nr result
ID: Zingiber24_contig00014860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00014860 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004969377.1| PREDICTED: 50S ribosomal protein L12, chloro... 59 7e-07 >ref|XP_004969377.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Setaria italica] Length = 181 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -3 Query: 259 PRRGCRRATFVRSPAAVSPKIEEIGTIISNLTLEEARSLVDHLQDRL 119 PRRG RRA V S A SPK+ E+G I+ LTLEEARSLVDHLQ+RL Sbjct: 34 PRRG-RRAVAVASTATESPKVLELGDAIAGLTLEEARSLVDHLQERL 79