BLASTX nr result
ID: Zingiber24_contig00014823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00014823 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301267.2| hypothetical protein POPTR_0002s14470g [Popu... 58 1e-06 ref|XP_006838126.1| hypothetical protein AMTR_s00106p00068380 [A... 55 7e-06 >ref|XP_002301267.2| hypothetical protein POPTR_0002s14470g [Populus trichocarpa] gi|550345015|gb|EEE80540.2| hypothetical protein POPTR_0002s14470g [Populus trichocarpa] Length = 260 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 343 EEEYAKEMSRIRKEIVNLHGEMVLLENYSSINYIG 239 E EY +EM +IRK+IVN HGEMVLLENYS+INY G Sbjct: 104 EAEYKEEMGKIRKDIVNFHGEMVLLENYSNINYTG 138 >ref|XP_006838126.1| hypothetical protein AMTR_s00106p00068380 [Amborella trichopoda] gi|548840584|gb|ERN00695.1| hypothetical protein AMTR_s00106p00068380 [Amborella trichopoda] Length = 239 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 352 RGREEEYAKEMSRIRKEIVNLHGEMVLLENYSSINYIG 239 R E EY + M++IRK++VN HGEMVLLENYS++NY G Sbjct: 93 RPSETEYEEAMAKIRKDMVNFHGEMVLLENYSNVNYTG 130