BLASTX nr result
ID: Zingiber24_contig00014415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00014415 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004967796.1| PREDICTED: transcription factor Pur-alpha 1-... 108 7e-22 ref|XP_004967795.1| PREDICTED: transcription factor Pur-alpha 1-... 108 7e-22 ref|XP_004967794.1| PREDICTED: transcription factor Pur-alpha 1-... 108 7e-22 emb|CBI16575.3| unnamed protein product [Vitis vinifera] 107 2e-21 ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1-... 107 2e-21 emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] 107 2e-21 gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] 107 2e-21 ref|NP_001241408.1| uncharacterized protein LOC100782805 [Glycin... 107 2e-21 gb|ESW29823.1| hypothetical protein PHAVU_002G101600g [Phaseolus... 106 3e-21 ref|XP_003566596.1| PREDICTED: transcription factor Pur-alpha 1-... 106 3e-21 dbj|BAJ89215.1| predicted protein [Hordeum vulgare subsp. vulgare] 106 3e-21 ref|NP_001141920.1| hypothetical protein [Zea mays] gi|194706458... 106 3e-21 gb|EOY32275.1| Transcription factor Pur-alpha 1 [Theobroma cacao] 105 5e-21 ref|XP_004505354.1| PREDICTED: transcription factor Pur-alpha 1-... 105 5e-21 ref|XP_004294929.1| PREDICTED: transcription factor Pur-alpha 1-... 105 5e-21 ref|XP_002523383.1| nucleic acid binding protein, putative [Rici... 105 5e-21 ref|XP_003607817.1| Transcription factor Pur-alpha [Medicago tru... 105 5e-21 ref|XP_003529454.1| PREDICTED: transcription factor Pur-alpha 1 ... 105 8e-21 ref|XP_002304844.2| hypothetical protein POPTR_0003s20690g [Popu... 104 1e-20 ref|XP_002455393.1| hypothetical protein SORBIDRAFT_03g010090 [S... 104 1e-20 >ref|XP_004967796.1| PREDICTED: transcription factor Pur-alpha 1-like isoform X3 [Setaria italica] Length = 304 Score = 108 bits (270), Expect = 7e-22 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV GADRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM+SANVRT+EP+QR Sbjct: 246 RGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMSSANVRTVEPSQR 304 >ref|XP_004967795.1| PREDICTED: transcription factor Pur-alpha 1-like isoform X2 [Setaria italica] Length = 305 Score = 108 bits (270), Expect = 7e-22 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV GADRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM+SANVRT+EP+QR Sbjct: 247 RGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMSSANVRTVEPSQR 305 >ref|XP_004967794.1| PREDICTED: transcription factor Pur-alpha 1-like isoform X1 [Setaria italica] Length = 310 Score = 108 bits (270), Expect = 7e-22 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV GADRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM+SANVRT+EP+QR Sbjct: 252 RGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMSSANVRTVEPSQR 310 >emb|CBI16575.3| unnamed protein product [Vitis vinifera] Length = 256 Score = 107 bits (267), Expect = 2e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHEMVGHFVEITKDR+EGM ANVRT++P QR Sbjct: 198 RGHFLRISEVAGSDRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 256 >ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1-like [Vitis vinifera] Length = 279 Score = 107 bits (267), Expect = 2e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHEMVGHFVEITKDR+EGM ANVRT++P QR Sbjct: 221 RGHFLRISEVAGSDRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 279 >emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] Length = 291 Score = 107 bits (267), Expect = 2e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHEMVGHFVEITKDR+EGM ANVRT++P QR Sbjct: 233 RGHFLRISEVAGSDRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 291 >gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] Length = 298 Score = 107 bits (266), Expect = 2e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM ANVRT+EP QR Sbjct: 240 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 298 >ref|NP_001241408.1| uncharacterized protein LOC100782805 [Glycine max] gi|255640975|gb|ACU20767.1| unknown [Glycine max] Length = 286 Score = 107 bits (266), Expect = 2e-21 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGMA ANVRT++P QR Sbjct: 228 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMAVANVRTIDPPQR 286 >gb|ESW29823.1| hypothetical protein PHAVU_002G101600g [Phaseolus vulgaris] Length = 284 Score = 106 bits (265), Expect = 3e-21 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGMA ANVRT++P QR Sbjct: 226 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMAVANVRTVDPPQR 284 >ref|XP_003566596.1| PREDICTED: transcription factor Pur-alpha 1-like [Brachypodium distachyon] Length = 310 Score = 106 bits (265), Expect = 3e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV GADRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM ANVRT+EP+QR Sbjct: 252 RGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 310 >dbj|BAJ89215.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 305 Score = 106 bits (265), Expect = 3e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV GADRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM ANVRT+EP+QR Sbjct: 247 RGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 305 >ref|NP_001141920.1| hypothetical protein [Zea mays] gi|194706458|gb|ACF87313.1| unknown [Zea mays] gi|414876890|tpg|DAA54021.1| TPA: hypothetical protein ZEAMMB73_358058 [Zea mays] Length = 308 Score = 106 bits (265), Expect = 3e-21 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV GADRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM ANVRT+EP+QR Sbjct: 250 RGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 308 >gb|EOY32275.1| Transcription factor Pur-alpha 1 [Theobroma cacao] Length = 362 Score = 105 bits (263), Expect = 5e-21 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM ANVRT++P QR Sbjct: 247 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 305 >ref|XP_004505354.1| PREDICTED: transcription factor Pur-alpha 1-like [Cicer arietinum] Length = 295 Score = 105 bits (263), Expect = 5e-21 Identities = 50/59 (84%), Positives = 56/59 (94%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM+ ANVRT++P QR Sbjct: 237 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMSVANVRTIDPPQR 295 >ref|XP_004294929.1| PREDICTED: transcription factor Pur-alpha 1-like [Fragaria vesca subsp. vesca] Length = 289 Score = 105 bits (263), Expect = 5e-21 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM ANVRT++P QR Sbjct: 231 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 289 >ref|XP_002523383.1| nucleic acid binding protein, putative [Ricinus communis] gi|223537333|gb|EEF38962.1| nucleic acid binding protein, putative [Ricinus communis] Length = 282 Score = 105 bits (263), Expect = 5e-21 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM ANVRT++P QR Sbjct: 224 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 282 >ref|XP_003607817.1| Transcription factor Pur-alpha [Medicago truncatula] gi|355508872|gb|AES90014.1| Transcription factor Pur-alpha [Medicago truncatula] Length = 293 Score = 105 bits (263), Expect = 5e-21 Identities = 50/59 (84%), Positives = 56/59 (94%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM+ ANVRT++P QR Sbjct: 235 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMSVANVRTIDPPQR 293 >ref|XP_003529454.1| PREDICTED: transcription factor Pur-alpha 1 isoform 1 [Glycine max] Length = 283 Score = 105 bits (261), Expect = 8e-21 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G+DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM ANVRT++P QR Sbjct: 225 RGHFLRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTVANVRTVDPPQR 283 >ref|XP_002304844.2| hypothetical protein POPTR_0003s20690g [Populus trichocarpa] gi|550343648|gb|EEE79823.2| hypothetical protein POPTR_0003s20690g [Populus trichocarpa] Length = 302 Score = 104 bits (260), Expect = 1e-20 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGHFLRISEV G DRSSIILPLSGLKQFHE+VGHFVEITKDR+EGM ANVRT++P QR Sbjct: 244 RGHFLRISEVAGNDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVDPPQR 302 >ref|XP_002455393.1| hypothetical protein SORBIDRAFT_03g010090 [Sorghum bicolor] gi|241927368|gb|EES00513.1| hypothetical protein SORBIDRAFT_03g010090 [Sorghum bicolor] Length = 312 Score = 104 bits (260), Expect = 1e-20 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +2 Query: 2 RGHFLRISEVTGADRSSIILPLSGLKQFHEMVGHFVEITKDRLEGMASANVRTLEPAQR 178 RGH+LRISEV G DRSSIILPLSGLKQFHEMVGHFV+I KDRLEGM ANVRT+EP+QR Sbjct: 254 RGHYLRISEVAGPDRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 312