BLASTX nr result
ID: Zingiber24_contig00013814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00013814 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515306.1| Chaperone protein dnaJ, putative [Ricinus co... 57 2e-06 gb|EXB59329.1| DnaJ homolog subfamily B member 11 [Morus notabilis] 55 1e-05 >ref|XP_002515306.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223545786|gb|EEF47290.1| Chaperone protein dnaJ, putative [Ricinus communis] Length = 345 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTKKGDLYVTYEVLFPKSLTEDQKTKIKAAL 95 +TKKGDLYVT+EVLFP SLTEDQKTKIKA L Sbjct: 314 STKKGDLYVTFEVLFPTSLTEDQKTKIKATL 344 >gb|EXB59329.1| DnaJ homolog subfamily B member 11 [Morus notabilis] Length = 344 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 NTKKGDLYVTYEVLFPKSLTEDQKTKIKAAL 95 +TKKGDLYVT+EVLFP SLTEDQKTKIK L Sbjct: 313 STKKGDLYVTFEVLFPTSLTEDQKTKIKEIL 343