BLASTX nr result
ID: Zingiber24_contig00013768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00013768 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464873.1| hypothetical protein SORBIDRAFT_01g027990 [S... 47 3e-07 >ref|XP_002464873.1| hypothetical protein SORBIDRAFT_01g027990 [Sorghum bicolor] gi|241918727|gb|EER91871.1| hypothetical protein SORBIDRAFT_01g027990 [Sorghum bicolor] Length = 319 Score = 47.4 bits (111), Expect(3) = 3e-07 Identities = 28/65 (43%), Positives = 30/65 (46%), Gaps = 6/65 (9%) Frame = +1 Query: 265 GFPYPPLLTPNFAXXXXXXXXXXXXXXXXXXXXXXXXXXWFPQSPSG------FLPILSP 426 GF +PP LTPNF WFPQSPSG FLPILSP Sbjct: 257 GFQHPPPLTPNFPALSPLPGTGILGPGPMPPPPSPGL--WFPQSPSGLLSPSGFLPILSP 314 Query: 427 RWRDM 441 RWRD+ Sbjct: 315 RWRDI 319 Score = 30.8 bits (68), Expect(3) = 3e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +1 Query: 1 AESPVSAYMRYLESSLLSS 57 A+SPVSAYMR LE+SL S+ Sbjct: 166 ADSPVSAYMRILENSLFSA 184 Score = 20.8 bits (42), Expect(3) = 3e-07 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 Query: 95 PPRGCFPPRAHPSPCLPP 148 PP P +HP P PP Sbjct: 208 PPHPHHPQPSHPHPPPPP 225