BLASTX nr result
ID: Zingiber24_contig00013165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00013165 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303946.2| hypothetical protein POPTR_0003s19300g [Popu... 99 8e-19 ref|XP_004303594.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 gb|EOY08858.1| Pentatricopeptide repeat-containing protein isofo... 91 1e-16 gb|EOY08857.1| Pentatricopeptide repeat-containing protein isofo... 91 1e-16 gb|AAF32491.1|AF091837_1 DNA-binding protein [Triticum aestivum] 91 1e-16 ref|XP_003624990.1| Pentatricopeptide repeat-containing protein ... 91 2e-16 ref|XP_006644067.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 emb|CBI30135.3| unnamed protein product [Vitis vinifera] 91 2e-16 ref|XP_002266581.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_006482077.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 ref|XP_006430551.1| hypothetical protein CICLE_v10011296mg [Citr... 89 8e-16 gb|EXC46728.1| hypothetical protein L484_002071 [Morus notabilis] 88 1e-15 ref|XP_003567340.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 gb|EPS66077.1| hypothetical protein M569_08698, partial [Genlise... 87 2e-15 gb|EMT04005.1| hypothetical protein F775_26459 [Aegilops tauschii] 87 2e-15 gb|EMS51226.1| hypothetical protein TRIUR3_21577 [Triticum urartu] 87 2e-15 gb|EXB28632.1| hypothetical protein L484_003155 [Morus notabilis] 87 3e-15 ref|XP_003590264.1| Pentatricopeptide repeat-containing protein ... 87 3e-15 ref|XP_003590239.1| Pentatricopeptide repeat-containing protein ... 87 3e-15 ref|XP_002889301.1| hypothetical protein ARALYDRAFT_477224 [Arab... 86 4e-15 >ref|XP_002303946.2| hypothetical protein POPTR_0003s19300g [Populus trichocarpa] gi|550343533|gb|EEE78925.2| hypothetical protein POPTR_0003s19300g [Populus trichocarpa] Length = 524 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/72 (66%), Positives = 55/72 (76%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQF EWLE KQ + E YA HLD IAKV GLW AEK+IEKIPESFR +L+Y TL Sbjct: 89 YWRALQFSEWLERSKQTDFTERDYACHLDCIAKVLGLWKAEKFIEKIPESFRGKLVYQTL 148 Query: 36 LANCVSAVNLKK 1 LA+CVS +N+KK Sbjct: 149 LASCVSVLNIKK 160 >ref|XP_004303594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 625 Score = 96.3 bits (238), Expect = 4e-18 Identities = 49/69 (71%), Positives = 51/69 (73%) Frame = -1 Query: 207 ALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLAN 28 ALQ EWLE KQIE E YAS LDLIAKV GLW AEKY+E IP+SFR E IY TLL N Sbjct: 208 ALQLSEWLEAHKQIEFSERDYASRLDLIAKVYGLWKAEKYVEMIPQSFRGEKIYRTLLVN 267 Query: 27 CVSAVNLKK 1 CV A NLKK Sbjct: 268 CVGANNLKK 276 >gb|EOY08858.1| Pentatricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] Length = 621 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/72 (66%), Positives = 53/72 (73%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ EWLE KQ++ E YAS LDLIAKV GL AE YIEKIP+SFR E+IY TL Sbjct: 201 YGRALQLSEWLEANKQLDFTERDYASRLDLIAKVRGLLKAEMYIEKIPKSFRGEVIYRTL 260 Query: 36 LANCVSAVNLKK 1 LANCV A N+KK Sbjct: 261 LANCVVANNVKK 272 >gb|EOY08857.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 623 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/72 (66%), Positives = 53/72 (73%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ EWLE KQ++ E YAS LDLIAKV GL AE YIEKIP+SFR E+IY TL Sbjct: 203 YGRALQLSEWLEANKQLDFTERDYASRLDLIAKVRGLLKAEMYIEKIPKSFRGEVIYRTL 262 Query: 36 LANCVSAVNLKK 1 LANCV A N+KK Sbjct: 263 LANCVVANNVKK 274 >gb|AAF32491.1|AF091837_1 DNA-binding protein [Triticum aestivum] Length = 612 Score = 91.3 bits (225), Expect = 1e-16 Identities = 45/72 (62%), Positives = 54/72 (75%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ +EWLE K I+LGE YAS LDL+AKV G++ AEKYI+ IP S R E++Y TL Sbjct: 192 YFKALQLLEWLEDSKVIDLGERDYASRLDLVAKVHGVYKAEKYIDSIPISHRGEIVYRTL 251 Query: 36 LANCVSAVNLKK 1 LANCVS N+KK Sbjct: 252 LANCVSEANVKK 263 >ref|XP_003624990.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500005|gb|AES81208.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 623 Score = 90.9 bits (224), Expect = 2e-16 Identities = 48/72 (66%), Positives = 53/72 (73%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ EWLE+ K +E E YAS LDLIAK+ GL AE YIEKIPESFR E+IY TL Sbjct: 204 YLKALQLSEWLESKKHLEFVERDYASQLDLIAKLHGLHKAEVYIEKIPESFRGEIIYRTL 263 Query: 36 LANCVSAVNLKK 1 LANCV+ NLKK Sbjct: 264 LANCVTQNNLKK 275 >ref|XP_006644067.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Oryza brachyantha] Length = 594 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/72 (59%), Positives = 55/72 (76%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ +E++E K ++LGE YASH+DL+AKV G++ AEKYIE IP S R E++Y TL Sbjct: 173 YRKALQLLEYVEESKLLDLGERDYASHVDLVAKVHGIYKAEKYIEDIPASHRGEIVYRTL 232 Query: 36 LANCVSAVNLKK 1 LANCVS N+KK Sbjct: 233 LANCVSIANVKK 244 >emb|CBI30135.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = -1 Query: 207 ALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLAN 28 ALQF EW+E K++++ E YAS +DLIAKV GL AE YIEKIP+SFR EL+Y TLLAN Sbjct: 207 ALQFSEWMEEHKKLDMVERDYASRVDLIAKVRGLQKAEHYIEKIPKSFRGELVYRTLLAN 266 Query: 27 CVSAVNLKK 1 CVS N KK Sbjct: 267 CVSTTNAKK 275 >ref|XP_002266581.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Vitis vinifera] Length = 587 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = -1 Query: 207 ALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLAN 28 ALQF EW+E K++++ E YAS +DLIAKV GL AE YIEKIP+SFR EL+Y TLLAN Sbjct: 170 ALQFSEWMEEHKKLDMVERDYASRVDLIAKVRGLQKAEHYIEKIPKSFRGELVYRTLLAN 229 Query: 27 CVSAVNLKK 1 CVS N KK Sbjct: 230 CVSTTNAKK 238 >ref|XP_006482077.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Citrus sinensis] Length = 623 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/72 (62%), Positives = 55/72 (76%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQF EWLET K+++ E YAS LDLIAK+ GL AE YI+KIPESFR E++Y TL Sbjct: 203 YGKALQFSEWLETNKKLDFIERDYASRLDLIAKLRGLQKAESYIQKIPESFRGEVVYRTL 262 Query: 36 LANCVSAVNLKK 1 LA+CV+ N+KK Sbjct: 263 LASCVAGNNVKK 274 >ref|XP_006430551.1| hypothetical protein CICLE_v10011296mg [Citrus clementina] gi|557532608|gb|ESR43791.1| hypothetical protein CICLE_v10011296mg [Citrus clementina] Length = 623 Score = 88.6 bits (218), Expect = 8e-16 Identities = 45/72 (62%), Positives = 54/72 (75%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ EWLET K+++ E YAS LDLIAK+ GL AE YI+KIPESFR E++Y TL Sbjct: 203 YGKALQLSEWLETNKKLDFIERDYASCLDLIAKLRGLQKAESYIQKIPESFRGEVVYRTL 262 Query: 36 LANCVSAVNLKK 1 LANCV+ N+KK Sbjct: 263 LANCVAGNNVKK 274 >gb|EXC46728.1| hypothetical protein L484_002071 [Morus notabilis] Length = 623 Score = 88.2 bits (217), Expect = 1e-15 Identities = 46/72 (63%), Positives = 54/72 (75%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQF EWLE+ K++EL E YAS +DLIAKV G AEK+IEKIP+S + EL+Y TL Sbjct: 203 YGKALQFSEWLESRKKLELVERDYASRVDLIAKVYGPQRAEKFIEKIPKSLKGELVYRTL 262 Query: 36 LANCVSAVNLKK 1 LANCV A N KK Sbjct: 263 LANCVQANNSKK 274 >ref|XP_003567340.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Brachypodium distachyon] Length = 612 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/72 (59%), Positives = 54/72 (75%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 + ALQ +EWLE K IEL E YAS LDL+AKV G++ AEK+I+ IP S R E++Y TL Sbjct: 192 FSKALQLLEWLEESKLIELVERDYASRLDLMAKVHGIYKAEKFIDNIPASLRGEIVYRTL 251 Query: 36 LANCVSAVNLKK 1 LANCV+ VN+KK Sbjct: 252 LANCVAEVNVKK 263 >gb|EPS66077.1| hypothetical protein M569_08698, partial [Genlisea aurea] Length = 538 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/69 (56%), Positives = 53/69 (76%) Frame = -1 Query: 207 ALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLAN 28 ALQ EWLE+ K +E+ E YASHLD +AKV G+ AE+Y+++IPESF E++Y T LAN Sbjct: 120 ALQLTEWLESKKHLEMSETNYASHLDFVAKVCGINKAEEYMKRIPESFMGEVVYRTFLAN 179 Query: 27 CVSAVNLKK 1 CV++ N+KK Sbjct: 180 CVASTNVKK 188 >gb|EMT04005.1| hypothetical protein F775_26459 [Aegilops tauschii] Length = 633 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = -1 Query: 201 QFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLANCV 22 Q +EWLE K I+LGE YAS LDL+AKV G++ AEKYI+ IP S R E++Y TLLANCV Sbjct: 217 QLLEWLEDSKVIDLGERDYASRLDLVAKVHGVYKAEKYIDSIPISHRGEIVYRTLLANCV 276 Query: 21 SAVNLKK 1 S N+KK Sbjct: 277 SEANVKK 283 >gb|EMS51226.1| hypothetical protein TRIUR3_21577 [Triticum urartu] Length = 633 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = -1 Query: 201 QFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLANCV 22 Q +EWLE K I+LGE YAS LDL+AKV G++ AEKYI+ IP S R E++Y TLLANCV Sbjct: 217 QLLEWLEDSKVIDLGERDYASRLDLVAKVHGVYKAEKYIDSIPISHRGEIVYRTLLANCV 276 Query: 21 SAVNLKK 1 S N+KK Sbjct: 277 SEANVKK 283 >gb|EXB28632.1| hypothetical protein L484_003155 [Morus notabilis] Length = 456 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/68 (64%), Positives = 51/68 (75%) Frame = -1 Query: 204 LQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTLLANC 25 L F EWLE K+IE E YAS +DLIAKV GL AEK+I++IP SFR E++Y TLLANC Sbjct: 38 LTFSEWLEAGKKIEFVERDYASRVDLIAKVYGLEKAEKHIDRIPNSFRGEIVYRTLLANC 97 Query: 24 VSAVNLKK 1 V A NLKK Sbjct: 98 VQAYNLKK 105 >ref|XP_003590264.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479312|gb|AES60515.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 557 Score = 86.7 bits (213), Expect = 3e-15 Identities = 43/72 (59%), Positives = 53/72 (73%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ ++WLE+ K++E E YAS LDLIAK+ GL AEKY+E +P SFR EL+Y TL Sbjct: 138 YGRALQALDWLESNKKLEFTEKEYASKLDLIAKLRGLPKAEKYLEHVPNSFRGELLYRTL 197 Query: 36 LANCVSAVNLKK 1 LANC S NL+K Sbjct: 198 LANCASLENLRK 209 >ref|XP_003590239.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479287|gb|AES60490.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 590 Score = 86.7 bits (213), Expect = 3e-15 Identities = 43/72 (59%), Positives = 53/72 (73%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ ++WLE+ K++E E YAS LDLIAK+ GL AEKY+E +P SFR EL+Y TL Sbjct: 187 YGRALQALDWLESNKKLEFTEKEYASKLDLIAKLRGLPKAEKYLEHVPNSFRGELLYRTL 246 Query: 36 LANCVSAVNLKK 1 LANC S NL+K Sbjct: 247 LANCASLENLRK 258 >ref|XP_002889301.1| hypothetical protein ARALYDRAFT_477224 [Arabidopsis lyrata subsp. lyrata] gi|297335142|gb|EFH65560.1| hypothetical protein ARALYDRAFT_477224 [Arabidopsis lyrata subsp. lyrata] Length = 597 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/72 (58%), Positives = 53/72 (73%) Frame = -1 Query: 216 YPMALQFVEWLETCKQIELGEWYYASHLDLIAKVSGLWNAEKYIEKIPESFRSELIYSTL 37 Y ALQ EWLE K+IE+ E Y+S LDL K+ GL N E Y++KIP+SF+ E+IY TL Sbjct: 177 YGRALQLSEWLEANKKIEMNERDYSSRLDLTVKIRGLENGEAYMQKIPKSFKGEVIYRTL 236 Query: 36 LANCVSAVNLKK 1 LANCV+A N+KK Sbjct: 237 LANCVAAGNVKK 248