BLASTX nr result
ID: Zingiber24_contig00012525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00012525 (282 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT03087.1| Serine/threonine-protein kinase-like protein CCR4... 55 1e-05 ref|NP_001235105.1| cytokinin-regulated kinase precursor [Glycin... 55 1e-05 >gb|EMT03087.1| Serine/threonine-protein kinase-like protein CCR4 [Aegilops tauschii] Length = 539 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 271 EAEAMAYMGHLAAECVRAEGRRRPSMGAVVMALKRALRVCSGEEHRP 131 E EA+AY+G+LAA+CVR GR RPSM VV L+RA+ C E P Sbjct: 475 EMEAVAYVGYLAADCVRLPGRERPSMSEVVGVLERAVAACEEHEDSP 521 >ref|NP_001235105.1| cytokinin-regulated kinase precursor [Glycine max] gi|223452420|gb|ACM89537.1| cytokinin-regulated kinase [Glycine max] Length = 769 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -3 Query: 271 EAEAMAYMGHLAAECVRAEGRRRPSMGAVVMALKRALRVCSGEEHRPRFSCDPIT 107 E EA+AY+G+LAA+CVR EGR RP+M VV L+RAL C + R + D I+ Sbjct: 713 EIEAVAYVGYLAADCVRLEGRDRPTMSQVVNNLERALAACLAKPILSRSTTDSIS 767