BLASTX nr result
ID: Zingiber24_contig00011956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00011956 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304010.2| kelch repeat-containing F-box family protein... 55 7e-06 >ref|XP_002304010.2| kelch repeat-containing F-box family protein [Populus trichocarpa] gi|550343698|gb|EEE78989.2| kelch repeat-containing F-box family protein [Populus trichocarpa] Length = 438 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 228 GQLKNFVASLWSSIAGRGGLKGHILHCQVLQA 133 G L+ V +LWSSIAGRGGLK HI+HCQVLQA Sbjct: 407 GHLRTLVTNLWSSIAGRGGLKSHIVHCQVLQA 438