BLASTX nr result
ID: Zingiber24_contig00011858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00011858 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK21070.1| unknown [Picea sitchensis] 58 1e-06 ref|XP_006839015.1| hypothetical protein AMTR_s00002p00272080 [A... 56 6e-06 gb|EOY05736.1| 20S proteasome beta subunit D1 [Theobroma cacao] 55 7e-06 >gb|ABK21070.1| unknown [Picea sitchensis] Length = 215 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 PNFVIKIVDKDGAKEYAWRETIKDAEEPTA*EL 101 PNFVIKIVDKDGA+EY WR+TI+DA EP A EL Sbjct: 175 PNFVIKIVDKDGAREYGWRKTIEDASEPPAAEL 207 >ref|XP_006839015.1| hypothetical protein AMTR_s00002p00272080 [Amborella trichopoda] gi|548841521|gb|ERN01584.1| hypothetical protein AMTR_s00002p00272080 [Amborella trichopoda] Length = 206 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 3 PNFVIKIVDKDGAKEYAWRETIKDAEEP 86 PNFVIKIVDKDGA+EYAWRET+KDA P Sbjct: 175 PNFVIKIVDKDGAREYAWRETVKDAGAP 202 >gb|EOY05736.1| 20S proteasome beta subunit D1 [Theobroma cacao] Length = 204 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 PNFVIKIVDKDGAKEYAWRETIKDAEEPTA 92 PNFVIKIVDKDGA+EYAWRE++KDAE +A Sbjct: 175 PNFVIKIVDKDGAREYAWRESVKDAEVASA 204