BLASTX nr result
ID: Zingiber24_contig00011397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00011397 (249 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306701.2| hypothetical protein POPTR_0005s21540g [Popu... 55 1e-05 ref|XP_006307532.1| hypothetical protein CARUB_v10009157mg, part... 55 1e-05 >ref|XP_002306701.2| hypothetical protein POPTR_0005s21540g [Populus trichocarpa] gi|550339460|gb|EEE93697.2| hypothetical protein POPTR_0005s21540g [Populus trichocarpa] Length = 429 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 115 PRTKHGLGLVAISYVALDYLRYVSPSWHARLQP 213 P+T GLGL AISYV +DYLR++SP+WH RLQP Sbjct: 8 PKTTAGLGLAAISYVVVDYLRHLSPTWHERLQP 40 >ref|XP_006307532.1| hypothetical protein CARUB_v10009157mg, partial [Capsella rubella] gi|482576243|gb|EOA40430.1| hypothetical protein CARUB_v10009157mg, partial [Capsella rubella] Length = 441 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = +1 Query: 73 SNTSPQASTCSAAMPRTKHGLGLVAISYVALDYLRYVSPSWHARLQP 213 S P +A T+ GLG+ A+SYVA+DY+RYVSP WH+RL P Sbjct: 6 STAKPGTMWLPSATQMTRGGLGIAAMSYVAIDYMRYVSPVWHSRLMP 52