BLASTX nr result
ID: Zingiber24_contig00011141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00011141 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280422.1| PREDICTED: uncharacterized protein LOC100247... 58 1e-06 ref|XP_002318249.1| hypothetical protein POPTR_0012s13830g [Popu... 58 1e-06 gb|EOY23079.1| ATP-dependent Clp protease ATP-binding subunit cl... 57 2e-06 ref|XP_006421835.1| hypothetical protein CICLE_v10005753mg [Citr... 56 4e-06 ref|XP_003533233.1| PREDICTED: uncharacterized protein LOC100790... 56 6e-06 ref|XP_002510850.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002280422.1| PREDICTED: uncharacterized protein LOC100247067 [Vitis vinifera] gi|297741122|emb|CBI31853.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 99 HKIKFETLRGCKLGISRYPDFEYNAEGGIGTAT 1 + +KF TL CKLGISRYPDFEYNAEGG GT T Sbjct: 54 YTVKFRTLGACKLGISRYPDFEYNAEGGTGTGT 86 >ref|XP_002318249.1| hypothetical protein POPTR_0012s13830g [Populus trichocarpa] gi|118485979|gb|ABK94834.1| unknown [Populus trichocarpa] gi|222858922|gb|EEE96469.1| hypothetical protein POPTR_0012s13830g [Populus trichocarpa] Length = 237 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 99 HKIKFETLRGCKLGISRYPDFEYNAEGGIGTAT 1 + + F+TL GCKLGISRYPDFEYNA+GG GT T Sbjct: 52 YTVNFKTLGGCKLGISRYPDFEYNAQGGTGTGT 84 >gb|EOY23079.1| ATP-dependent Clp protease ATP-binding subunit clpX [Theobroma cacao] Length = 239 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 99 HKIKFETLRGCKLGISRYPDFEYNAEGGIGTAT 1 + I F+TL CKLGISRYPDFEYNAEGG GT T Sbjct: 57 YSISFKTLGACKLGISRYPDFEYNAEGGAGTGT 89 >ref|XP_006421835.1| hypothetical protein CICLE_v10005753mg [Citrus clementina] gi|568874425|ref|XP_006490316.1| PREDICTED: uncharacterized protein LOC102616840 [Citrus sinensis] gi|557523708|gb|ESR35075.1| hypothetical protein CICLE_v10005753mg [Citrus clementina] Length = 239 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 93 IKFETLRGCKLGISRYPDFEYNAEGGIGTAT 1 + F+T++ CKLGISRYPDFEYNAEGG GT T Sbjct: 59 VNFKTMKACKLGISRYPDFEYNAEGGKGTGT 89 >ref|XP_003533233.1| PREDICTED: uncharacterized protein LOC100790681 [Glycine max] Length = 238 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 99 HKIKFETLRGCKLGISRYPDFEYNAEGGIGT 7 + + F+T +GCKLGISRYPDFEY+AEGGIGT Sbjct: 52 YTVSFKTEKGCKLGISRYPDFEYDAEGGIGT 82 >ref|XP_002510850.1| conserved hypothetical protein [Ricinus communis] gi|223549965|gb|EEF51452.1| conserved hypothetical protein [Ricinus communis] Length = 240 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 99 HKIKFETLRGCKLGISRYPDFEYNAEGGIGT 7 + + F+TL CKLGISRYPDFEYNAEGG GT Sbjct: 55 YTVNFKTLEACKLGISRYPDFEYNAEGGTGT 85