BLASTX nr result
ID: Zingiber24_contig00011108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00011108 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351014.1| PREDICTED: probable mediator of RNA polymera... 57 3e-06 >ref|XP_006351014.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c-like [Solanum tuberosum] Length = 348 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 407 NAKKQRTIQVMDIHEIPKPKNSFV--RKGVFHGKH 309 NAKKQRTIQVMDIHEIPKPKN F+ KG F G+H Sbjct: 312 NAKKQRTIQVMDIHEIPKPKNGFIAKNKGGFQGRH 346