BLASTX nr result
ID: Zingiber24_contig00009896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00009896 (484 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB99770.1| Protein phosphatase 2C 29 [Morus notabilis] 67 3e-09 ref|XP_006847698.1| hypothetical protein AMTR_s00149p00066780 [A... 67 3e-09 ref|XP_006485433.1| PREDICTED: protein phosphatase 2C 29-like [C... 66 4e-09 ref|XP_006352839.1| PREDICTED: protein phosphatase 2C 29-like [S... 66 4e-09 gb|ESW28651.1| hypothetical protein PHAVU_002G006100g [Phaseolus... 66 4e-09 gb|ESW27756.1| hypothetical protein PHAVU_003G229400g [Phaseolus... 66 4e-09 ref|XP_006436752.1| hypothetical protein CICLE_v100317272mg, par... 66 4e-09 ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Popu... 66 4e-09 gb|EOY24048.1| Poltergeist like 1 isoform 1 [Theobroma cacao] 66 4e-09 ref|XP_004509008.1| PREDICTED: protein phosphatase 2C 29-like is... 66 4e-09 ref|XP_004301696.1| PREDICTED: protein phosphatase 2C 29-like [F... 66 4e-09 gb|EMJ12502.1| hypothetical protein PRUPE_ppa001785mg [Prunus pe... 66 4e-09 ref|XP_004245878.1| PREDICTED: protein phosphatase 2C 29-like [S... 66 4e-09 ref|XP_004167593.1| PREDICTED: protein phosphatase 2C 29-like [C... 66 4e-09 ref|XP_004148729.1| PREDICTED: protein phosphatase 2C 29-like [C... 66 4e-09 ref|XP_003550942.1| PREDICTED: protein phosphatase 2C 29-like [G... 66 4e-09 ref|XP_003524053.1| PREDICTED: protein phosphatase 2C 29-like [G... 66 4e-09 ref|XP_003608636.1| Protein phosphatase 2C [Medicago truncatula]... 66 4e-09 ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [V... 66 4e-09 ref|XP_002519843.1| protein phosphatase 2c, putative [Ricinus co... 66 4e-09 >gb|EXB99770.1| Protein phosphatase 2C 29 [Morus notabilis] Length = 898 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGKCV 372 LLDIPQGDRRKYHDDVTVM+ISLE GRIWKSSGK + Sbjct: 761 LLDIPQGDRRKYHDDVTVMIISLE--GRIWKSSGKTI 795 >ref|XP_006847698.1| hypothetical protein AMTR_s00149p00066780 [Amborella trichopoda] gi|548850967|gb|ERN09279.1| hypothetical protein AMTR_s00149p00066780 [Amborella trichopoda] Length = 981 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGKCV 372 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK + Sbjct: 947 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGKYI 981 >ref|XP_006485433.1| PREDICTED: protein phosphatase 2C 29-like [Citrus sinensis] Length = 792 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 758 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 790 >ref|XP_006352839.1| PREDICTED: protein phosphatase 2C 29-like [Solanum tuberosum] Length = 798 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 764 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 796 >gb|ESW28651.1| hypothetical protein PHAVU_002G006100g [Phaseolus vulgaris] Length = 764 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 730 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 762 >gb|ESW27756.1| hypothetical protein PHAVU_003G229400g [Phaseolus vulgaris] Length = 690 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 656 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 688 >ref|XP_006436752.1| hypothetical protein CICLE_v100317272mg, partial [Citrus clementina] gi|557538948|gb|ESR49992.1| hypothetical protein CICLE_v100317272mg, partial [Citrus clementina] Length = 167 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 133 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 165 >ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Populus trichocarpa] gi|550342758|gb|ERP63425.1| hypothetical protein POPTR_0003s08790g [Populus trichocarpa] Length = 169 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 135 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 167 >gb|EOY24048.1| Poltergeist like 1 isoform 1 [Theobroma cacao] Length = 786 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 752 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 784 >ref|XP_004509008.1| PREDICTED: protein phosphatase 2C 29-like isoform X1 [Cicer arietinum] Length = 775 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 741 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 773 >ref|XP_004301696.1| PREDICTED: protein phosphatase 2C 29-like [Fragaria vesca subsp. vesca] Length = 761 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 727 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 759 >gb|EMJ12502.1| hypothetical protein PRUPE_ppa001785mg [Prunus persica] Length = 765 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 731 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 763 >ref|XP_004245878.1| PREDICTED: protein phosphatase 2C 29-like [Solanum lycopersicum] Length = 796 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 762 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 794 >ref|XP_004167593.1| PREDICTED: protein phosphatase 2C 29-like [Cucumis sativus] Length = 782 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 748 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 780 >ref|XP_004148729.1| PREDICTED: protein phosphatase 2C 29-like [Cucumis sativus] Length = 781 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 747 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 779 >ref|XP_003550942.1| PREDICTED: protein phosphatase 2C 29-like [Glycine max] Length = 701 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 667 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 699 >ref|XP_003524053.1| PREDICTED: protein phosphatase 2C 29-like [Glycine max] Length = 696 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 662 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 694 >ref|XP_003608636.1| Protein phosphatase 2C [Medicago truncatula] gi|355509691|gb|AES90833.1| Protein phosphatase 2C [Medicago truncatula] Length = 818 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 784 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 816 >ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [Vitis vinifera] Length = 822 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 788 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 820 >ref|XP_002519843.1| protein phosphatase 2c, putative [Ricinus communis] gi|223540889|gb|EEF42447.1| protein phosphatase 2c, putative [Ricinus communis] Length = 749 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 482 LLDIPQGDRRKYHDDVTVMVISLEVDGRIWKSSGK 378 LLDIPQGDRRKYHDDVTVMVISLE GRIWKSSGK Sbjct: 715 LLDIPQGDRRKYHDDVTVMVISLE--GRIWKSSGK 747