BLASTX nr result
ID: Zingiber24_contig00009626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00009626 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] 111 9e-23 gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao] gi|508724... 111 1e-22 ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [C... 111 1e-22 gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] 111 1e-22 ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus... 111 1e-22 ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus... 111 1e-22 emb|CBI28706.3| unnamed protein product [Vitis vinifera] 110 1e-22 gb|EMJ27040.1| hypothetical protein PRUPE_ppa011659mg [Prunus pe... 110 2e-22 ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocar... 110 2e-22 gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] 109 3e-22 emb|CBI18243.3| unnamed protein product [Vitis vinifera] 109 3e-22 gb|ACS96445.1| S18.A ribosomal protein [Jatropha curcas] 109 3e-22 ref|XP_002282412.1| PREDICTED: 40S ribosomal protein S18-like [V... 109 3e-22 gb|ACM90157.1| S18 ribosomal protein [Jatropha curcas] 109 3e-22 ref|XP_002306780.1| hypothetical protein POPTR_0005s23280g [Popu... 109 3e-22 ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [A... 109 4e-22 ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycin... 109 4e-22 ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citr... 108 6e-22 ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citr... 108 6e-22 ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycin... 108 6e-22 >gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] Length = 225 Score = 111 bits (278), Expect = 9e-23 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -3 Query: 172 VAMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 +AMSLV NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 72 LAMSLVTNEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 128 >gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao] gi|508724927|gb|EOY16824.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|508724928|gb|EOY16825.1| S18 ribosomal protein isoform 1 [Theobroma cacao] Length = 152 Score = 111 bits (277), Expect = 1e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] gi|449525091|ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Length = 152 Score = 111 bits (277), Expect = 1e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] Length = 152 Score = 111 bits (277), Expect = 1e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223540104|gb|EEF41681.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|313586541|gb|ADR71281.1| 40S ribosomal protein S18A [Hevea brasiliensis] Length = 152 Score = 111 bits (277), Expect = 1e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223536431|gb|EEF38080.1| 40S ribosomal protein S18, putative [Ricinus communis] Length = 152 Score = 111 bits (277), Expect = 1e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >emb|CBI28706.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 110 bits (276), Expect = 1e-22 Identities = 55/64 (85%), Positives = 57/64 (89%) Frame = -3 Query: 193 RETLDHDVAMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 14 R + MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD Sbjct: 752 RRASSETLTMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 811 Query: 13 MNKR 2 MNKR Sbjct: 812 MNKR 815 >gb|EMJ27040.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica] Length = 202 Score = 110 bits (274), Expect = 2e-22 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 1/66 (1%) Frame = -3 Query: 196 KRETLDHDVA-MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKAD 20 +RE + + A MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKAD Sbjct: 40 QRERANPNAATMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKAD 99 Query: 19 VDMNKR 2 VDMNKR Sbjct: 100 VDMNKR 105 >ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocarpa] gi|222856964|gb|EEE94511.1| 40S ribosomal protein S18 [Populus trichocarpa] Length = 152 Score = 110 bits (274), Expect = 2e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRF+NIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNIVCKKADVDMNKR 55 >gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] Length = 152 Score = 109 bits (273), Expect = 3e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >emb|CBI18243.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 109 bits (273), Expect = 3e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 43 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 97 >gb|ACS96445.1| S18.A ribosomal protein [Jatropha curcas] Length = 152 Score = 109 bits (273), Expect = 3e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >ref|XP_002282412.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] gi|225460586|ref|XP_002262702.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] gi|359479621|ref|XP_003632303.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] Length = 152 Score = 109 bits (273), Expect = 3e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >gb|ACM90157.1| S18 ribosomal protein [Jatropha curcas] Length = 152 Score = 109 bits (273), Expect = 3e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >ref|XP_002306780.1| hypothetical protein POPTR_0005s23280g [Populus trichocarpa] gi|118481499|gb|ABK92692.1| unknown [Populus trichocarpa] gi|222856229|gb|EEE93776.1| hypothetical protein POPTR_0005s23280g [Populus trichocarpa] Length = 152 Score = 109 bits (273), Expect = 3e-22 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 55 >ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda] gi|548846846|gb|ERN06075.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda] Length = 152 Score = 109 bits (272), Expect = 4e-22 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSL+ANEDFQHILRVLNTNVDG+QKIMFALTSIKGIGRRFANIVCKKAD+DMNKR Sbjct: 1 MSLIANEDFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANIVCKKADIDMNKR 55 >ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycine max] Length = 152 Score = 109 bits (272), Expect = 4e-22 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANI CKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKR 55 >ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] gi|568838213|ref|XP_006473109.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557536642|gb|ESR47760.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] Length = 152 Score = 108 bits (271), Expect = 6e-22 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKR 55 >ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] gi|568872460|ref|XP_006489386.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557521804|gb|ESR33171.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] Length = 152 Score = 108 bits (271), Expect = 6e-22 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKR 55 >ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycine max] gi|255629053|gb|ACU14871.1| unknown [Glycine max] Length = 152 Score = 108 bits (271), Expect = 6e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 166 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKR 2 MSLVANEDFQHILRVLNTNVDGKQKIMFA+TSIKGIGRRFANI CKKADVDMNKR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKR 55