BLASTX nr result
ID: Zingiber24_contig00009085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00009085 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62268.1| hypothetical protein L484_022156 [Morus notabilis] 56 4e-06 >gb|EXB62268.1| hypothetical protein L484_022156 [Morus notabilis] Length = 175 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 210 DDEEYVKETTEMINKLRSTINMDKQDPNVATA 305 +DEEYVKET E+INK+R+TINMDK DPNVA A Sbjct: 71 EDEEYVKETAEVINKVRTTINMDKNDPNVAAA 102