BLASTX nr result
ID: Zingiber24_contig00007929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00007929 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006646109.1| PREDICTED: probable polygalacturonase-like [... 55 1e-05 >ref|XP_006646109.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha] Length = 444 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -2 Query: 273 TRVVPWVCADVSGGALEVQPAACSELTSTNSMNFCTTAL 157 T V PW C VSG AL+VQP+ C+ELTST+ M+FCT +L Sbjct: 406 TPVRPWKCEAVSGAALDVQPSPCTELTSTSGMSFCTNSL 444