BLASTX nr result
ID: Zingiber24_contig00007503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00007503 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838261.1| hypothetical protein AMTR_s00103p00063820 [A... 56 6e-06 >ref|XP_006838261.1| hypothetical protein AMTR_s00103p00063820 [Amborella trichopoda] gi|548840729|gb|ERN00830.1| hypothetical protein AMTR_s00103p00063820 [Amborella trichopoda] Length = 471 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +2 Query: 2 VPEEISGLISQFLSSLPKLTKKIKEEPIPEHIQRLFDEA 118 VP+EIS I+ F+SSLPK +++KE+PIPEHI+++FDEA Sbjct: 403 VPDEISEAIADFVSSLPKSIREMKEDPIPEHIRKMFDEA 441