BLASTX nr result
ID: Zingiber24_contig00007332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00007332 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522037.1| malate dehydrogenase, putative [Ricinus comm... 58 1e-06 >ref|XP_002522037.1| malate dehydrogenase, putative [Ricinus communis] gi|223538636|gb|EEF40237.1| malate dehydrogenase, putative [Ricinus communis] Length = 356 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -3 Query: 133 MQQSAEASRRIAALSAQLHPPGLQMQGIPPLRLENCRAKGGAPG 2 M SAEA++RIA +SA LHPP QM+G L+ +CRAKGG+PG Sbjct: 1 MDSSAEAAQRIARISAHLHPPNFQMEGSSALKRADCRAKGGSPG 44