BLASTX nr result
ID: Zingiber24_contig00007305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00007305 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143677.1| PREDICTED: ethylene-responsive transcription... 57 3e-06 >ref|XP_004143677.1| PREDICTED: ethylene-responsive transcription factor 5-like [Cucumis sativus] Length = 237 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/74 (41%), Positives = 37/74 (50%) Frame = +1 Query: 37 RKRETEGEGVAAGWRAVKRERSPETEGSSDGQVPLACPLTPSSWKGVWDGETAGIFNXXX 216 R+RE+E E V G + +K+E ETE G CPLTPS W VWD + GIFN Sbjct: 165 RRRESESEVVEMGKKEMKKEERSETE--EIGVPTTVCPLTPSCWASVWDSDGKGIFNVPP 222 Query: 217 XXXXXXXRFPQLTV 258 PQ TV Sbjct: 223 LSPYPLMGHPQCTV 236