BLASTX nr result
ID: Zingiber24_contig00006975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00006975 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650695.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid ox... 59 9e-07 ref|XP_002317470.1| glycolate oxidase family protein [Populus tr... 57 3e-06 gb|ABY61829.1| hemoglobin/glycolate oxidase fusion protein [synt... 56 6e-06 gb|ADX97325.1| glycolate oxidase [Mangifera indica] 55 1e-05 >ref|XP_006650695.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Oryza brachyantha] Length = 422 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 7/73 (9%) Frame = +2 Query: 74 PTKESPSHIPSPYIYCP---PLHTLRSFISPGISEQGCKTMSM----EVTNVMEYEAIAK 232 P P +P+P P P H S + P +S++ C+ E+TNV EY+AIAK Sbjct: 10 PLSSLPPILPAPTPLPPVLAPSHCTASLL-PSVSQERCRVCKAGQMGEITNVTEYQAIAK 68 Query: 233 QKLPKMVFDYYAS 271 QKLPKM++DYYAS Sbjct: 69 QKLPKMIYDYYAS 81 >ref|XP_002317470.1| glycolate oxidase family protein [Populus trichocarpa] gi|118489504|gb|ABK96554.1| unknown [Populus trichocarpa x Populus deltoides] gi|222860535|gb|EEE98082.1| glycolate oxidase family protein [Populus trichocarpa] Length = 369 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 191 MEVTNVMEYEAIAKQKLPKMVFDYYAS 271 ME+TNVMEYEAIAKQKLPKMVFDYYAS Sbjct: 1 MEITNVMEYEAIAKQKLPKMVFDYYAS 27 >gb|ABY61829.1| hemoglobin/glycolate oxidase fusion protein [synthetic construct] Length = 525 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 164 SEQGCKTMSMEVTNVMEYEAIAKQKLPKMVFDYYAS 271 S G + SME+TNV EYEAIAKQKLPKMV+DYYAS Sbjct: 148 SGSGSGSGSMEITNVNEYEAIAKQKLPKMVYDYYAS 183 >gb|ADX97325.1| glycolate oxidase [Mangifera indica] Length = 370 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 194 EVTNVMEYEAIAKQKLPKMVFDYYAS 271 E+TNVMEYEAIAKQKLPKMVFDYYAS Sbjct: 3 EITNVMEYEAIAKQKLPKMVFDYYAS 28