BLASTX nr result
ID: Zingiber24_contig00005895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00005895 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21255.3| unnamed protein product [Vitis vinifera] 55 1e-05 >emb|CBI21255.3| unnamed protein product [Vitis vinifera] Length = 160 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = +3 Query: 84 SSLFSSKMVLPNDIDLLNPPAXXXXXXXXXXXXVQSPNSFFMDV 215 S+ S+KMVLPNDIDLLNPPA VQSPNSFFMDV Sbjct: 68 SAKVSTKMVLPNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDV 111