BLASTX nr result
ID: Zingiber24_contig00004972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00004972 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819... 99 6e-19 pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Ar... 99 6e-19 ref|XP_006403964.1| hypothetical protein EUTSA_v10010795mg [Eutr... 97 2e-18 ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Caps... 97 2e-18 gb|EMT33623.1| hypothetical protein F775_43350 [Aegilops tauschii] 96 5e-18 gb|ESW30604.1| hypothetical protein PHAVU_002G167100g [Phaseolus... 95 1e-17 pdb|2VLT|A Chain A, Crystal Structure Of Barley Thioredoxin H Is... 95 1e-17 dbj|BAJ99002.1| predicted protein [Hordeum vulgare subsp. vulgare] 95 1e-17 ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus commun... 95 1e-17 gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] 94 1e-17 gb|AEC03321.1| thioredoxin H-type 6 [Hevea brasiliensis] 94 2e-17 ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb... 94 2e-17 ref|NP_199112.1| thioredoxin H3 [Arabidopsis thaliana] gi|182063... 92 5e-17 ref|XP_006654619.1| PREDICTED: thioredoxin H-type-like [Oryza br... 92 5e-17 sp|O64394.3|TRXH_WHEAT RecName: Full=Thioredoxin H-type; Short=T... 92 7e-17 gb|AAL24517.1|AF420472_1 thioredoxin H [Triticum aestivum] gi|29... 92 7e-17 ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citr... 92 7e-17 emb|CAB96931.1| thioredoxin h [Triticum aestivum] gi|9502274|gb|... 92 7e-17 ref|XP_002310830.2| thioredoxin h family protein [Populus tricho... 92 9e-17 emb|CCQ38271.1| thioredoxin H-type protein, partial [Schiedea ap... 91 1e-16 >ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819804|ref|XP_002877785.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|267122|sp|P29448.1|TRXH1_ARATH RecName: Full=Thioredoxin H1; Short=AtTrxh1; AltName: Full=Thioredoxin 1; Short=AtTRX1 gi|16552|emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana] gi|1388080|gb|AAC49354.1| thioredoxin h [Arabidopsis thaliana] gi|6562255|emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana] gi|21617958|gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana] gi|297323623|gb|EFH54044.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|332645218|gb|AEE78739.1| thioredoxin H1 [Arabidopsis thaliana] Length = 114 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/56 (78%), Positives = 47/56 (83%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE W QL+ ANESK LVV+DFTASWCGPCR IAP FADLA K PNV+FLKV Sbjct: 10 ACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKV 65 >pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/56 (78%), Positives = 47/56 (83%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE W QL+ ANESK LVV+DFTASWCGPCR IAP FADLA K PNV+FLKV Sbjct: 20 ACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKV 75 >ref|XP_006403964.1| hypothetical protein EUTSA_v10010795mg [Eutrema salsugineum] gi|557105083|gb|ESQ45417.1| hypothetical protein EUTSA_v10010795mg [Eutrema salsugineum] Length = 152 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/56 (76%), Positives = 46/56 (82%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE W QL+ N+SK LVV+DFTASWCGPCR IAP FADLA K PNVIFLKV Sbjct: 48 ACHTVESWNEQLQKGNDSKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVIFLKV 103 >ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] gi|482561483|gb|EOA25674.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] Length = 114 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE W QL+ AN+SK LVV+DFTA+WCGPCR IAP FADLA K PNV+FLKV Sbjct: 10 ACHTVESWNEQLQKANDSKTLVVVDFTATWCGPCRFIAPFFADLAKKLPNVLFLKV 65 >gb|EMT33623.1| hypothetical protein F775_43350 [Aegilops tauschii] Length = 694 Score = 95.9 bits (237), Expect = 5e-18 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = +3 Query: 108 HTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 HT+E+WT Q+E AN +KKLVV+DFTASWCGPCR++AP+FADLA KFPN +FLKV Sbjct: 22 HTLEQWTMQIEEANAAKKLVVVDFTASWCGPCRIMAPVFADLAKKFPNAVFLKV 75 >gb|ESW30604.1| hypothetical protein PHAVU_002G167100g [Phaseolus vulgaris] Length = 120 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE WT QL+ N+SKKL+V+DFTASWCGPCR I+P A+LA KF NV+FLKV Sbjct: 12 ACHTVEAWTEQLQKGNDSKKLIVVDFTASWCGPCRFISPFLAELAKKFTNVVFLKV 67 >pdb|2VLT|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In The Oxidized State gi|186972809|pdb|2VLT|B Chain B, Crystal Structure Of Barley Thioredoxin H Isoform 2 In The Oxidized State gi|186972810|pdb|2VLU|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In Partially Radiation-Reduced State gi|186972811|pdb|2VLU|B Chain B, Crystal Structure Of Barley Thioredoxin H Isoform 2 In Partially Radiation-Reduced State gi|186972812|pdb|2VLV|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In Partially Radiation-Reduced State gi|186972813|pdb|2VLV|B Chain B, Crystal Structure Of Barley Thioredoxin H Isoform 2 In Partially Radiation-Reduced State gi|32186042|gb|AAP72291.1| thioredoxin h isoform 2 [Hordeum vulgare subsp. vulgare] gi|326518510|dbj|BAJ88284.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 122 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = +3 Query: 108 HTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 H++E+WT Q+E AN +KKLVVIDFTASWCGPCR++AP+FADLA KFPN +FLKV Sbjct: 18 HSLEQWTMQIEEANTAKKLVVIDFTASWCGPCRIMAPVFADLAKKFPNAVFLKV 71 >dbj|BAJ99002.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 148 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = +3 Query: 108 HTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 H++E+WT Q+E AN +KKLVVIDFTASWCGPCR++AP+FADLA KFPN +FLKV Sbjct: 44 HSLEQWTMQIEEANTAKKLVVIDFTASWCGPCRIMAPVFADLAKKFPNAVFLKV 97 >ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus communis] gi|223551157|gb|EEF52643.1| Thioredoxin H-type, putative [Ricinus communis] Length = 118 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE WT QLE E+KKL+V+DFTASWCGPCR IAPI A++A K PNV FLKV Sbjct: 9 ACHTVEAWTEQLEKGQETKKLIVVDFTASWCGPCRFIAPILAEMAKKMPNVTFLKV 64 >gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 94.4 bits (233), Expect = 1e-17 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = +3 Query: 105 CHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 CHTVE W QL+ NESKKLVV+DFTASWCGPCR IAP A+LA K PNV+FLKV Sbjct: 11 CHTVESWNEQLQKGNESKKLVVVDFTASWCGPCRFIAPFLAELAKKLPNVMFLKV 65 >gb|AEC03321.1| thioredoxin H-type 6 [Hevea brasiliensis] Length = 117 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 +CHTVE WT QL+ ESKKL+V+DFTASWCGPCR+I PI A+LA K PNVIFLKV Sbjct: 9 SCHTVEAWTDQLDKGQESKKLIVVDFTASWCGPCRLINPILAELAKKMPNVIFLKV 64 >ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb|ABV71991.1| thioredoxin h1 [Glycine max] Length = 120 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 +CHTVEEW QL+ NESKKL+V+DFTASWCGPCR IAP A+LA KF +VIFLKV Sbjct: 12 SCHTVEEWNDQLQKGNESKKLIVVDFTASWCGPCRFIAPFLAELAKKFTSVIFLKV 67 >ref|NP_199112.1| thioredoxin H3 [Arabidopsis thaliana] gi|18206377|sp|Q42403.1|TRXH3_ARATH RecName: Full=Thioredoxin H3; Short=AtTrxh3; AltName: Full=Thioredoxin 3; Short=AtTRX3 gi|992962|emb|CAA84611.1| thioredoxin [Arabidopsis thaliana] gi|1388076|gb|AAC49351.1| thioredoxin h [Arabidopsis thaliana] gi|9758587|dbj|BAB09200.1| thioredoxin (clone GIF1) [Arabidopsis thaliana] gi|16649001|gb|AAL24352.1| thioredoxin (clone GIF1) [Arabidopsis thaliana] gi|17473621|gb|AAL38274.1| thioredoxin (clone GIF1) [Arabidopsis thaliana] gi|20259940|gb|AAM13317.1| thioredoxin [Arabidopsis thaliana] gi|21386963|gb|AAM47885.1| thioredoxin clone GIF1 [Arabidopsis thaliana] gi|21537330|gb|AAM61671.1| thioredoxin [Arabidopsis thaliana] gi|332007514|gb|AED94897.1| thioredoxin H3 [Arabidopsis thaliana] Length = 118 Score = 92.4 bits (228), Expect = 5e-17 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 ACHTVE+WT +L+ ANESKKL+VIDFTA+WC PCR IAP+FADLA K +V+F KV Sbjct: 9 ACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKV 64 >ref|XP_006654619.1| PREDICTED: thioredoxin H-type-like [Oryza brachyantha] Length = 121 Score = 92.4 bits (228), Expect = 5e-17 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = +3 Query: 102 ACHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 A H++EEWT Q+E AN +KKLVVIDFTA+WCGPCR+I P+FADLA K P V+FLKV Sbjct: 16 AIHSLEEWTIQIEAANSAKKLVVIDFTAAWCGPCRIIGPVFADLAKKHPGVVFLKV 71 >sp|O64394.3|TRXH_WHEAT RecName: Full=Thioredoxin H-type; Short=Trx-H; AltName: Full=TrxTa gi|2995378|emb|CAA49540.1| unnamed protein product [Triticum aestivum] Length = 127 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = +3 Query: 108 HTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 H++E+WT Q+E AN +KKLVVIDFTASWCGPCR++APIFADLA KFP +FLKV Sbjct: 24 HSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKV 77 >gb|AAL24517.1|AF420472_1 thioredoxin H [Triticum aestivum] gi|2995380|emb|CAA05081.1| thioredoxin H [Triticum durum] Length = 130 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = +3 Query: 108 HTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 H++E+WT Q+E AN +KKLVVIDFTASWCGPCR++APIFADLA KFP +FLKV Sbjct: 27 HSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKV 80 >ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|568824998|ref|XP_006466877.1| PREDICTED: thioredoxin H-type-like [Citrus sinensis] gi|119367477|gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] gi|557527581|gb|ESR38831.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 119 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = +3 Query: 105 CHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 CHTVE W QL+ +NE+K+LVV+DFTASWCGPCR IAP A+LA K PNV+FLKV Sbjct: 12 CHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKV 66 >emb|CAB96931.1| thioredoxin h [Triticum aestivum] gi|9502274|gb|AAF88067.1| thioredoxin H [Triticum aestivum] Length = 125 Score = 92.0 bits (227), Expect = 7e-17 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = +3 Query: 108 HTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 H++E+WT Q+E AN +KKLVVIDFTASWCGPCR++APIFADLA KFP +FLKV Sbjct: 22 HSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKV 75 >ref|XP_002310830.2| thioredoxin h family protein [Populus trichocarpa] gi|118481453|gb|ABK92669.1| unknown [Populus trichocarpa] gi|550334812|gb|EEE91280.2| thioredoxin h family protein [Populus trichocarpa] Length = 122 Score = 91.7 bits (226), Expect = 9e-17 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = +3 Query: 105 CHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 CHTVE W QL+ NESKKLVVIDF ASWCGPCR+IAP A+LA K P+VIFLKV Sbjct: 11 CHTVEAWDEQLQRGNESKKLVVIDFAASWCGPCRVIAPFLAELARKLPDVIFLKV 65 >emb|CCQ38271.1| thioredoxin H-type protein, partial [Schiedea apokremnos] Length = 134 Score = 91.3 bits (225), Expect = 1e-16 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +3 Query: 105 CHTVEEWTRQLELANESKKLVVIDFTASWCGPCRMIAPIFADLAMKFPNVIFLKV 269 CHTV++WT L++A ESKKLVV+DFTASWCGPCR IAP + A K+PNV+FLKV Sbjct: 3 CHTVQQWTHHLDIAKESKKLVVVDFTASWCGPCRTIAPFVDECAKKYPNVLFLKV 57