BLASTX nr result
ID: Zingiber24_contig00004970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00004970 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB61163.1| Photosystem I reaction center subunit XI [Morus n... 59 7e-07 >gb|EXB61163.1| Photosystem I reaction center subunit XI [Morus notabilis] Length = 224 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 7/66 (10%) Frame = -1 Query: 178 MAVASAPSMASQLKSTNLLCSSTSRPLVNPKGISG------PSLTRKR-LCLTVRAIQAE 20 MA+ASA MASQ K++ C+++ L +PKGI G PS R R C TVRAIQ+E Sbjct: 1 MAIASASPMASQPKNSITRCAASWELLASPKGICGSQLRALPSFNRSRPRCFTVRAIQSE 60 Query: 19 KPTYQV 2 KPTYQV Sbjct: 61 KPTYQV 66