BLASTX nr result
ID: Zingiber24_contig00004350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00004350 (208 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO09338.2| sucrose synthase [Musa acuminata AAA Group] 57 2e-06 >gb|AEO09338.2| sucrose synthase [Musa acuminata AAA Group] Length = 816 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 100 MPQRSLTRALSVRERIGDSLSSHPNELVALFSR 2 M QR+LTRA S RERIGDSLSSHPNELVALFSR Sbjct: 1 MSQRTLTRAHSFRERIGDSLSSHPNELVALFSR 33