BLASTX nr result
ID: Zingiber24_contig00004076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00004076 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439099.1| hypothetical protein CICLE_v10033132mg [Citr... 68 1e-09 ref|XP_003599258.1| Photosystem II 5 kDa protein [Medicago trunc... 65 1e-08 ref|XP_003599257.1| Photosystem II 5 kDa protein [Medicago trunc... 65 1e-08 gb|ESW03384.1| hypothetical protein PHAVU_011G009700g [Phaseolus... 62 1e-07 gb|AFK48333.1| unknown [Medicago truncatula] 62 1e-07 ref|XP_004499891.1| PREDICTED: photosystem II 5 kDa protein, chl... 61 1e-07 gb|EOY32695.1| Photosystem II 5 kD protein, putative [Theobroma ... 61 2e-07 ref|XP_002452351.1| hypothetical protein SORBIDRAFT_04g024130 [S... 61 2e-07 ref|XP_002298398.1| predicted protein [Populus trichocarpa] gi|1... 61 2e-07 ref|XP_002277909.1| PREDICTED: photosystem II 5 kDa protein, chl... 61 2e-07 gb|AFK47048.1| unknown [Lotus japonicus] 60 2e-07 ref|XP_004952905.1| PREDICTED: photosystem II 5 kDa protein, chl... 60 4e-07 ref|NP_564589.1| photosystem II 5 kD protein [Arabidopsis thalia... 60 4e-07 ref|XP_006446137.1| hypothetical protein CICLE_v10017247mg [Citr... 59 5e-07 ref|XP_002314076.1| photosystem II 5 kD family protein [Populus ... 59 5e-07 ref|XP_006369585.1| hypothetical protein POPTR_0001s26410g [Popu... 59 7e-07 gb|EOX96667.1| Photosystem II 5 kDa protein, chloroplastic [Theo... 59 7e-07 gb|EMT23305.1| hypothetical protein F775_30333 [Aegilops tauschii] 59 7e-07 ref|XP_004291777.1| PREDICTED: photosystem II 5 kDa protein, chl... 59 7e-07 ref|XP_002517817.1| Photosystem II 5 kDa protein, chloroplast pr... 59 7e-07 >ref|XP_006439099.1| hypothetical protein CICLE_v10033132mg [Citrus clementina] gi|568858657|ref|XP_006482864.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Citrus sinensis] gi|557541295|gb|ESR52339.1| hypothetical protein CICLE_v10033132mg [Citrus clementina] Length = 109 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 36 GQGIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 G GIAMA +EPK GTPEAKK Y PVCVTMPTAK+CHK Sbjct: 73 GIGIAMAAEEPKAGTPEAKKFYAPVCVTMPTAKVCHK 109 >ref|XP_003599258.1| Photosystem II 5 kDa protein [Medicago truncatula] gi|355488306|gb|AES69509.1| Photosystem II 5 kDa protein [Medicago truncatula] gi|388501032|gb|AFK38582.1| unknown [Medicago truncatula] Length = 105 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 G+AMA DEP+RGTPEAKKKYGPVCVT PTA+IC Sbjct: 71 GVAMADDEPRRGTPEAKKKYGPVCVTNPTARIC 103 >ref|XP_003599257.1| Photosystem II 5 kDa protein [Medicago truncatula] gi|355488305|gb|AES69508.1| Photosystem II 5 kDa protein [Medicago truncatula] Length = 106 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 G+AMA +EPKRGTPEAKKKY PVCVTMPTA+IC Sbjct: 72 GVAMADEEPKRGTPEAKKKYAPVCVTMPTARIC 104 >gb|ESW03384.1| hypothetical protein PHAVU_011G009700g [Phaseolus vulgaris] Length = 106 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 G++MA DEPKRGTPEAKK Y P+CVTMPTA+ICHK Sbjct: 73 GMSMA-DEPKRGTPEAKKIYYPICVTMPTARICHK 106 >gb|AFK48333.1| unknown [Medicago truncatula] Length = 108 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 G+A+A DEPKRG+PEAKK Y PVCVTMPTA+IC Sbjct: 74 GMALAADEPKRGSPEAKKAYAPVCVTMPTARIC 106 >ref|XP_004499891.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Cicer arietinum] Length = 105 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 G+AMA DEPKRGTPEAKKKY VCVT PTAKIC Sbjct: 71 GVAMADDEPKRGTPEAKKKYAVVCVTNPTAKIC 103 >gb|EOY32695.1| Photosystem II 5 kD protein, putative [Theobroma cacao] Length = 122 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 45 IAMALDEPKRGTPEAKKKYGPVCVTMPTAKICH 143 +AM ++PK GTPEAKKKY P+CVTMPTA++CH Sbjct: 74 VAMGAEDPKAGTPEAKKKYAPICVTMPTARVCH 106 >ref|XP_002452351.1| hypothetical protein SORBIDRAFT_04g024130 [Sorghum bicolor] gi|241932182|gb|EES05327.1| hypothetical protein SORBIDRAFT_04g024130 [Sorghum bicolor] Length = 152 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 36 GQGIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICH 143 G G AMA +PK+G+PEAKKKY P+CVTMPTAKICH Sbjct: 118 GAGAAMA--DPKKGSPEAKKKYAPICVTMPTAKICH 151 >ref|XP_002298398.1| predicted protein [Populus trichocarpa] gi|118487685|gb|ABK95667.1| unknown [Populus trichocarpa] gi|118488853|gb|ABK96236.1| unknown [Populus trichocarpa x Populus deltoides] gi|118488867|gb|ABK96243.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489821|gb|ABK96710.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489889|gb|ABK96742.1| unknown [Populus trichocarpa x Populus deltoides] Length = 105 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 45 IAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 +A+A +EP+RGTPEAKKKY P+CVTMPTA+IC K Sbjct: 72 VAIADEEPERGTPEAKKKYAPICVTMPTARICRK 105 >ref|XP_002277909.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic [Vitis vinifera] gi|147792102|emb|CAN66292.1| hypothetical protein VITISV_027031 [Vitis vinifera] Length = 109 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 GIAMA EPK GTPEAKK Y P+CVTMPTAKICHK Sbjct: 76 GIAMA-GEPKPGTPEAKKIYAPICVTMPTAKICHK 109 >gb|AFK47048.1| unknown [Lotus japonicus] Length = 107 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 GIA+A DEPK G+PEAKKKY PVCVTMPTA++C K Sbjct: 70 GIALA-DEPKNGSPEAKKKYAPVCVTMPTARVCRK 103 >ref|XP_004952905.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Setaria italica] Length = 107 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 36 GQGIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICH 143 G G AMA PK GTPEAKKKY P+CVTMPTAK+CH Sbjct: 73 GAGAAMA--GPKNGTPEAKKKYAPICVTMPTAKVCH 106 >ref|NP_564589.1| photosystem II 5 kD protein [Arabidopsis thaliana] gi|4836947|gb|AAD30649.1|AC006085_22 Putative photosystem II 5 KD protein [Arabidopsis thaliana] gi|12325362|gb|AAG52621.1|AC024261_8 unknown protein; 88255-88575 [Arabidopsis thaliana] gi|14326535|gb|AAK60312.1|AF385721_1 At1g51400/F5D21_10 [Arabidopsis thaliana] gi|15215584|gb|AAK91337.1| At1g51400/F5D21_10 [Arabidopsis thaliana] gi|22137316|gb|AAM91503.1| At1g51400/F5D21_10 [Arabidopsis thaliana] gi|332194541|gb|AEE32662.1| photosystem II 5 kD protein [Arabidopsis thaliana] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 45 IAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 +AMA DEPKRGT AKKKY PVCVTMPTAKIC Sbjct: 73 VAMADDEPKRGTEAAKKKYAPVCVTMPTAKIC 104 >ref|XP_006446137.1| hypothetical protein CICLE_v10017247mg [Citrus clementina] gi|568832832|ref|XP_006470630.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Citrus sinensis] gi|557548748|gb|ESR59377.1| hypothetical protein CICLE_v10017247mg [Citrus clementina] Length = 111 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +3 Query: 45 IAMA-LDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 +AMA +EPKRGTP+AKKKY PVCVTMPTA+IC K Sbjct: 77 VAMAESEEPKRGTPDAKKKYAPVCVTMPTARICRK 111 >ref|XP_002314076.1| photosystem II 5 kD family protein [Populus trichocarpa] gi|222850484|gb|EEE88031.1| photosystem II 5 kD family protein [Populus trichocarpa] Length = 105 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 45 IAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 +A+A +EP+RGTPEAKKKY P+CVTMPTA+IC Sbjct: 72 VAIADEEPRRGTPEAKKKYAPICVTMPTARIC 103 >ref|XP_006369585.1| hypothetical protein POPTR_0001s26410g [Populus trichocarpa] gi|550348232|gb|ERP66154.1| hypothetical protein POPTR_0001s26410g [Populus trichocarpa] Length = 110 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 45 IAMALDEPKRGTPEAKKKYGPVCVTMPTAKIC 140 +A+A +EP+RGTPEAKKKY P+CVTMPTA+IC Sbjct: 29 VAIADEEPERGTPEAKKKYAPICVTMPTARIC 60 >gb|EOX96667.1| Photosystem II 5 kDa protein, chloroplastic [Theobroma cacao] Length = 106 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 G+A A DEPK GTPEA+K Y P+CVTMPTA+ICHK Sbjct: 73 GVAAA-DEPKPGTPEARKVYAPICVTMPTARICHK 106 >gb|EMT23305.1| hypothetical protein F775_30333 [Aegilops tauschii] Length = 106 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICH 143 G+A A + K+G+PEAKKKY PVC+TMPTAKICH Sbjct: 72 GVAFAESDVKKGSPEAKKKYAPVCITMPTAKICH 105 >ref|XP_004291777.1| PREDICTED: photosystem II 5 kDa protein, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 104 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 45 IAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 +AMA DEP+RGTP AKKKY PVCVTMPTA+IC K Sbjct: 72 VAMA-DEPERGTPAAKKKYAPVCVTMPTARICRK 104 >ref|XP_002517817.1| Photosystem II 5 kDa protein, chloroplast precursor, putative [Ricinus communis] gi|223543089|gb|EEF44624.1| Photosystem II 5 kDa protein, chloroplast precursor, putative [Ricinus communis] Length = 104 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 42 GIAMALDEPKRGTPEAKKKYGPVCVTMPTAKICHK 146 G+A A +EPK GTPEAKK Y PVCVTMPTA+ICHK Sbjct: 71 GVAAA-EEPKAGTPEAKKFYSPVCVTMPTARICHK 104