BLASTX nr result
ID: Zingiber24_contig00002444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00002444 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Syn... 114 1e-23 ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea may... 114 1e-23 gb|AFW63835.1| glutamine synthetase5 [Zea mays] 114 1e-23 gb|ACR38147.1| unknown [Zea mays] gi|413923904|gb|AFW63836.1| gl... 114 1e-23 gb|ACB06727.1| glutamine synthetase [Zea mays] 114 1e-23 ref|NP_001241743.1| glutamine synthetase root isozyme 3 [Zea may... 114 1e-23 gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum] 114 2e-23 gb|EXC36091.1| Glutamine synthetase nodule isozyme [Morus notabi... 113 2e-23 gb|EXB95908.1| Glutamine synthetase nodule isozyme [Morus notabi... 113 2e-23 sp|P32289.1|GLNA_VIGAC RecName: Full=Glutamine synthetase nodule... 113 2e-23 gb|EMJ23375.1| hypothetical protein PRUPE_ppa007771mg [Prunus pe... 113 2e-23 gb|AFP20991.1| glutamine synthetase isozyme [Zea mays] 113 3e-23 ref|NP_001242332.1| cytosolic glutamine synthetase beta2 [Glycin... 112 5e-23 gb|AGI78873.1| glutamine synthetase [Vigna unguiculata] gi|47754... 112 7e-23 gb|AGG19203.1| glutamine synthetase [Vigna unguiculata] 112 7e-23 emb|CAG27625.1| putative glutamine synthetase [Populus x canaden... 112 7e-23 ref|XP_002310666.1| glutamine synthetase family protein [Populus... 112 7e-23 gb|AAR29057.1| glutamine synthetase 1 [Datisca glomerata] 112 7e-23 gb|AGC24237.1| glutamine synthetase 1 [Brassica napus] 111 9e-23 gb|AGC24234.1| glutamine synthetase 1 [Brassica napus] gi|440808... 111 9e-23 >pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490285|pdb|2D3A|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490286|pdb|2D3A|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490287|pdb|2D3A|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490288|pdb|2D3A|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490289|pdb|2D3A|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490290|pdb|2D3A|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490291|pdb|2D3A|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490292|pdb|2D3A|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490293|pdb|2D3A|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490296|pdb|2D3B|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490297|pdb|2D3B|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490298|pdb|2D3B|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490299|pdb|2D3B|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490300|pdb|2D3B|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490301|pdb|2D3B|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490302|pdb|2D3B|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490303|pdb|2D3B|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490304|pdb|2D3B|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490305|pdb|2D3B|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490309|pdb|2D3C|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490310|pdb|2D3C|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490311|pdb|2D3C|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490312|pdb|2D3C|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490313|pdb|2D3C|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490314|pdb|2D3C|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490315|pdb|2D3C|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490316|pdb|2D3C|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490317|pdb|2D3C|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490318|pdb|2D3C|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|286122|dbj|BAA03430.1| glutamine synthetase [Zea mays] Length = 356 Score = 114 bits (286), Expect = 1e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea mays] gi|585204|sp|P38562.1|GLNA4_MAIZE RecName: Full=Glutamine synthetase root isozyme 4; AltName: Full=GS107; AltName: Full=Glutamate--ammonia ligase gi|434330|emb|CAA46722.1| glutamine synthetase [Zea mays] Length = 355 Score = 114 bits (286), Expect = 1e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >gb|AFW63835.1| glutamine synthetase5 [Zea mays] Length = 309 Score = 114 bits (286), Expect = 1e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >gb|ACR38147.1| unknown [Zea mays] gi|413923904|gb|AFW63836.1| glutamine synthetase5 [Zea mays] Length = 356 Score = 114 bits (286), Expect = 1e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >gb|ACB06727.1| glutamine synthetase [Zea mays] Length = 356 Score = 114 bits (286), Expect = 1e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >ref|NP_001241743.1| glutamine synthetase root isozyme 3 [Zea mays] gi|195625212|gb|ACG34436.1| glutamine synthetase root isozyme 3 [Zea mays] Length = 356 Score = 114 bits (286), Expect = 1e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum] Length = 356 Score = 114 bits (284), Expect = 2e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL DLINLNLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MSLLNDLINLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >gb|EXC36091.1| Glutamine synthetase nodule isozyme [Morus notabilis] Length = 327 Score = 113 bits (283), Expect = 2e-23 Identities = 51/57 (89%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LLTDL+NLNLSDTT++IIAEYIWIGGSGLD+RSKARTLPGPVTDP+KLPKWNYDG Sbjct: 1 MSLLTDLLNLNLSDTTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPAKLPKWNYDG 57 >gb|EXB95908.1| Glutamine synthetase nodule isozyme [Morus notabilis] Length = 356 Score = 113 bits (283), Expect = 2e-23 Identities = 51/57 (89%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DL+NLNLSDTTE+IIAEYIWIGGSGLD+RSKARTLPGPV+DPSKLPKWNYDG Sbjct: 1 MSLLSDLVNLNLSDTTEKIIAEYIWIGGSGLDVRSKARTLPGPVSDPSKLPKWNYDG 57 >sp|P32289.1|GLNA_VIGAC RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; AltName: Full=Glutamate--ammonia ligase gi|170637|gb|AAA34239.1| glutamine synthetase [Vigna aconitifolia] gi|1094850|prf||2106409A Gln synthetase Length = 356 Score = 113 bits (283), Expect = 2e-23 Identities = 52/57 (91%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DLINLNLSDTTE+IIAEYIWIGGSGLD+RSKARTLPGPV+DPSKLPKWNYDG Sbjct: 1 MSLLSDLINLNLSDTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSKLPKWNYDG 57 >gb|EMJ23375.1| hypothetical protein PRUPE_ppa007771mg [Prunus persica] Length = 356 Score = 113 bits (283), Expect = 2e-23 Identities = 52/57 (91%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DLINLNLSD+TE+IIAEYIWIGGSGLD+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MSLLSDLINLNLSDSTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSKLPKWNYDG 57 >gb|AFP20991.1| glutamine synthetase isozyme [Zea mays] Length = 356 Score = 113 bits (282), Expect = 3e-23 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 MA LTDL+NLNLSDTTE+ IAEYIWIGGSG+D+RSKARTLPGPVTDPSKLPKWNYDG Sbjct: 1 MACLTDLVNLNLSDTTEKFIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDG 57 >ref|NP_001242332.1| cytosolic glutamine synthetase beta2 [Glycine max] gi|255645255|gb|ACU23125.1| unknown [Glycine max] Length = 356 Score = 112 bits (280), Expect = 5e-23 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DLINLNLSDTTE++IAEYIWIGGSG+D+RSKARTLPGPV+DPSKLPKWNYDG Sbjct: 1 MSLLSDLINLNLSDTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDG 57 >gb|AGI78873.1| glutamine synthetase [Vigna unguiculata] gi|477542057|gb|AGI78874.1| glutamine synthetase [Vigna unguiculata] gi|477542059|gb|AGI78875.1| glutamine synthetase [Vigna unguiculata] Length = 356 Score = 112 bits (279), Expect = 7e-23 Identities = 51/57 (89%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DLINLNLSDTTE+IIAEYIWIGGSGLD+RSKARTLPGPV+DPS+LPKWNYDG Sbjct: 1 MSLLSDLINLNLSDTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDG 57 >gb|AGG19203.1| glutamine synthetase [Vigna unguiculata] Length = 360 Score = 112 bits (279), Expect = 7e-23 Identities = 51/57 (89%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DLINLNLSDTTE+IIAEYIWIGGSGLD+RSKARTLPGPV+DPS+LPKWNYDG Sbjct: 1 MSLLSDLINLNLSDTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDG 57 >emb|CAG27625.1| putative glutamine synthetase [Populus x canadensis] Length = 72 Score = 112 bits (279), Expect = 7e-23 Identities = 50/57 (87%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL DLIN+NLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDP+KLPKWNYDG Sbjct: 1 MSLLNDLININLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDG 57 >ref|XP_002310666.1| glutamine synthetase family protein [Populus trichocarpa] gi|118483322|gb|ABK93563.1| unknown [Populus trichocarpa] gi|222853569|gb|EEE91116.1| glutamine synthetase family protein [Populus trichocarpa] Length = 356 Score = 112 bits (279), Expect = 7e-23 Identities = 50/57 (87%), Positives = 56/57 (98%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL DLIN+NLSDTTE+IIAEYIWIGGSG+D+RSKARTLPGPVTDP+KLPKWNYDG Sbjct: 1 MSLLNDLININLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDG 57 >gb|AAR29057.1| glutamine synthetase 1 [Datisca glomerata] Length = 356 Score = 112 bits (279), Expect = 7e-23 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DL+NLNLSD+TE++IAEYIWIGGSGLDIRSKARTLPGPV+DPSKLPKWNYDG Sbjct: 1 MSLLSDLVNLNLSDSTEKVIAEYIWIGGSGLDIRSKARTLPGPVSDPSKLPKWNYDG 57 >gb|AGC24237.1| glutamine synthetase 1 [Brassica napus] Length = 354 Score = 111 bits (278), Expect = 9e-23 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DL+NLNLSD+T+QIIAEYIWIGGSG+DIRSKARTLPGPV+DPSKLPKWNYDG Sbjct: 1 MSLLSDLVNLNLSDSTKQIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDG 57 >gb|AGC24234.1| glutamine synthetase 1 [Brassica napus] gi|440808124|gb|AGC24236.1| glutamine synthetase 1 [Brassica napus] Length = 354 Score = 111 bits (278), Expect = 9e-23 Identities = 50/57 (87%), Positives = 57/57 (100%) Frame = -3 Query: 173 MALLTDLINLNLSDTTEQIIAEYIWIGGSGLDIRSKARTLPGPVTDPSKLPKWNYDG 3 M+LL+DL+NLNLSD+TE+IIAEYIWIGGSG+DIRSKARTLPGPV+DPSKLPKWNYDG Sbjct: 1 MSLLSDLVNLNLSDSTEKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDG 57