BLASTX nr result
ID: Zingiber24_contig00002101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00002101 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 86 7e-15 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 86 7e-15 gb|ACU14391.1| unknown [Glycine max] 86 7e-15 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 86 7e-15 gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus pe... 85 9e-15 gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] 84 1e-14 ref|XP_003536025.1| PREDICTED: hydrophobic protein LTI6A-like [G... 84 1e-14 ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus... 84 1e-14 ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [G... 84 2e-14 gb|ACU14699.1| unknown [Glycine max] 84 2e-14 gb|ACU14681.1| unknown [Glycine max] 84 2e-14 ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [F... 83 3e-14 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 83 3e-14 gb|EPS65277.1| hypothetical protein M569_09505, partial [Genlise... 83 4e-14 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 83 4e-14 ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus ... 82 6e-14 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] 82 7e-14 ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatu... 82 7e-14 gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago tru... 82 7e-14 ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like is... 82 1e-13 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GCQVEFWICL+LTLFGYIPGI+YAVYAITK Sbjct: 65 LPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYAITK 104 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC+VEFWICLLLT+FGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ACU14391.1| unknown [Glycine max] Length = 57 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GCQVEFWICL+LTLFGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC++EFWICLLLTLFGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC VEFWICLLLT+FGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] Length = 58 Score = 84.3 bits (207), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GC+VEFWICL+LTLFGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKYGCEVEFWICLVLTLFGYIPGIIYAVYAITK 57 >ref|XP_003536025.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 84.3 bits (207), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GCQVEFWICL+LTLFGYIPGI+YAVY+ITK Sbjct: 18 LPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYSITK 57 >ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis] gi|223548547|gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis] Length = 56 Score = 84.3 bits (207), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GC+VEFWICL+LTLFGYIPGI+YAVYAITK Sbjct: 17 LPPLGVFLKYGCKVEFWICLILTLFGYIPGIIYAVYAITK 56 >ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GC+VEFWICL+LTLFGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|ACU14699.1| unknown [Glycine max] Length = 57 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GC+VEFWICL+LTLFGYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|ACU14681.1| unknown [Glycine max] Length = 57 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLK+GCQVEFWICL+LTLFGYIPGI+YAVY ITK Sbjct: 18 LPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYTITK 57 >ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. vesca] Length = 57 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC VEFWICLLLT+FGYIPGI+YA+Y ITK Sbjct: 18 LPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYVITK 57 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC+VEFW+CLLLT FGY+PGI+YAVYAITK Sbjct: 17 LPPLGVFLKFGCKVEFWLCLLLTFFGYLPGIIYAVYAITK 56 >gb|EPS65277.1| hypothetical protein M569_09505, partial [Genlisea aurea] Length = 51 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC++EFWICL+LTLFGYIPGI+YAVYA+TK Sbjct: 12 LPPLGVFLKFGCKLEFWICLILTLFGYIPGILYAVYALTK 51 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC VEFWICL+LT FGYIPGI+YA+YAITK Sbjct: 18 LPPLGVFLKFGCHVEFWICLVLTFFGYIPGIIYAIYAITK 57 >ref|XP_002329990.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 57 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC VEFWICLLLT FGY+PGI+YA+YAITK Sbjct: 18 LPPLGVFLKFGCGVEFWICLLLTFFGYLPGIIYAIYAITK 57 >gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 82.0 bits (201), Expect = 7e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC+ EFWICLLLTLFGY+PGI+YAVY ITK Sbjct: 18 LPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula] gi|355501150|gb|AES82353.1| Hydrophobic protein LTI6B [Medicago truncatula] Length = 83 Score = 82.0 bits (201), Expect = 7e-14 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC VEFW+CL+LTLFGY+PGI+YA+YAITK Sbjct: 15 LPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula] Length = 54 Score = 82.0 bits (201), Expect = 7e-14 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC VEFW+CL+LTLFGY+PGI+YA+YAITK Sbjct: 15 LPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Citrus sinensis] gi|568853390|ref|XP_006480342.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Citrus sinensis] Length = 58 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 LPPLGVFLKFGCQVEFWICLLLTLFGYIPGIVYAVYAITK 120 LPPLGVFLKFGC+ EFWICLLLT+ GYIPGI+YAVYAITK Sbjct: 18 LPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57