BLASTX nr result
ID: Zingiber24_contig00002092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00002092 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV03161.1| germin-like protein [Chimonanthus praecox] 55 1e-05 >gb|ABV03161.1| germin-like protein [Chimonanthus praecox] Length = 214 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 1 PDPGIQITALSLFSNNLPSEIVEAVTFLDDAEV 99 P PG+QITA +LF+NNLPSE+VE TFLDDA+V Sbjct: 171 PSPGLQITAFALFANNLPSELVEKTTFLDDAQV 203