BLASTX nr result
ID: Zingiber24_contig00000896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00000896 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548249.1| PREDICTED: chlorophyll a-b binding protein C... 56 4e-06 gb|ACU23386.1| unknown [Glycine max] 56 4e-06 ref|XP_004512591.1| PREDICTED: chlorophyll a-b binding protein C... 55 1e-05 >ref|XP_003548249.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic [Glycine max] Length = 289 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +2 Query: 68 SEILGTRLNATVTPRAAPS-HSPGSSKVTALFXXXXXXXXXXXXXXXXXXDELAKWYGPD 244 SE+LG +N + R APS SP S K ALF DELAKWYGPD Sbjct: 16 SEMLGNPINLSGATRPAPSASSPASFKTVALFSKKKAAPPKKAAAAAPANDELAKWYGPD 75 Query: 245 RRIFLP 262 RRIFLP Sbjct: 76 RRIFLP 81 >gb|ACU23386.1| unknown [Glycine max] Length = 289 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +2 Query: 68 SEILGTRLNATVTPRAAPS-HSPGSSKVTALFXXXXXXXXXXXXXXXXXXDELAKWYGPD 244 SE+LG +N + R APS SP S K ALF DELAKWYGPD Sbjct: 16 SEMLGNPINLSGATRPAPSASSPASFKTVALFSKKKAAPPKKAAAAAPANDELAKWYGPD 75 Query: 245 RRIFLP 262 RRIFLP Sbjct: 76 RRIFLP 81 >ref|XP_004512591.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Cicer arietinum] Length = 289 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +2 Query: 68 SEILGTRLNATVTPRAAPSHS-PGSSKVTALFXXXXXXXXXXXXXXXXXXDELAKWYGPD 244 SE+LG +N + R+APS S P + K ALF DELAKWYGPD Sbjct: 16 SEMLGNPINFSGATRSAPSPSTPSTFKTVALFSKKKAAPPPKQKVSTPANDELAKWYGPD 75 Query: 245 RRIFLP 262 RRIFLP Sbjct: 76 RRIFLP 81