BLASTX nr result
ID: Zingiber24_contig00000560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00000560 (448 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 72 1e-10 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 71 2e-10 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 70 4e-10 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 69 5e-10 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 69 6e-10 gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] 69 8e-10 emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] 69 8e-10 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 67 2e-09 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 67 2e-09 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 67 2e-09 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 65 7e-09 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 65 1e-08 dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] 65 1e-08 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 gb|AFP57435.1| putative metallothionein type 3 [Brassica napus] 64 3e-08 dbj|BAB85600.1| metallothionein type 3 [Brassica juncea] 63 5e-08 ref|XP_002329134.1| predicted protein [Populus trichocarpa] 62 1e-07 ref|NP_566509.1| metallothionein 3 [Arabidopsis thaliana] gi|233... 61 1e-07 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 61 1e-07 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCG+C CADKSQCVKKG SY ++I+ETEKS N V+D +A+ E Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDASAAAE 45 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCG+C CADKSQCVKKG SY ++I+ETEKS N V+D A+ E Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDAPAAAE 45 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAAS 442 MSTCG+C CADKSQCVKKG SY V+I+ETEKSY +GV + AA+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAA 43 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCG+C CADKSQCVKKG SY ++I+ETEKSY++ VV+ A+ + Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVVEAPAAAK 45 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCG+C C DKSQCVKKG SY +DIVETEKSY++ V+ A + E Sbjct: 1 MSTCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAE 45 >gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] Length = 63 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCGDC CADKSQCVKKG Y + I+ETEKSY VV+ AA+ E Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAE 45 >emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] Length = 63 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCGDC CADKSQCVKKG Y + I+ETEKSY VV+ AA+ E Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAE 45 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 MSTCG+C CADKSQCVKKG SY +DIVETEKSY+ VV Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVV 38 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASG 445 STCG+C CADKSQCVKKG+SYT DIVETEKS+++ +V +G Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAG 45 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 STCG+C CADKSQCVKKG+SYT DIVETEKS+++ VV Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVV 39 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 STCG+C CADKSQCVKKG+SYT DIVETEKS+++ ++ + E Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAE 46 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCG+C CADKSQCVKKG YT++I+ETEKS+ V + E Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAE 45 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 320 TCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAAS 442 TCG+C CADK+QCVKKG+SYT DI+ETEKS + V+D A+ Sbjct: 4 TCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAA 44 >dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 MS+CG+C CADK+QCVKKGTSYT+DIVET++SY ++ Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTLDIVETQESYKEAMI 38 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 STCG+C CADKSQCVKKG+SYT D+VETEKS ++ +V Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIV 39 >gb|AFP57435.1| putative metallothionein type 3 [Brassica napus] Length = 67 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 MS+CG+C CADK+QCVKKGTSYT DIVET++SY ++ Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTFDIVETKESYKEAMI 38 >dbj|BAB85600.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 314 MSTCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVVDGAASGE 448 MSTCG+C CADK+QCVKK TSYT DIVET++SY ++ + E Sbjct: 1 MSTCGNCDCADKTQCVKKVTSYTFDIVETQESYKEAMIMDVSGAE 45 >ref|XP_002329134.1| predicted protein [Populus trichocarpa] Length = 66 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 STC +C CADK+QCVKKG+SYT IVETEK+Y++ VV Sbjct: 3 STCDNCDCADKTQCVKKGSSYTAGIVETEKNYVSSVV 39 >ref|NP_566509.1| metallothionein 3 [Arabidopsis thaliana] gi|2338712|gb|AAB67234.1| metallothionein-like protein [Arabidopsis thaliana] gi|9294268|dbj|BAB02170.1| metallothionein-like protein [Arabidopsis thaliana] gi|18377773|gb|AAL67036.1| unknown protein [Arabidopsis thaliana] gi|20259219|gb|AAM14325.1| unknown protein [Arabidopsis thaliana] gi|21592819|gb|AAM64769.1| metallothionein-like protein [Arabidopsis thaliana] gi|110738955|dbj|BAF01398.1| hypothetical protein [Arabidopsis thaliana] gi|332642134|gb|AEE75655.1| metallothionein 3 [Arabidopsis thaliana] Length = 69 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLNGVV 427 S CG C CADK+QCVKKGTSYT DIVET++SY ++ Sbjct: 3 SNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMI 39 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +2 Query: 317 STCGDCSCADKSQCVKKGTSYTVDIVETEKSYLN-GVVDGAAS 442 STC +C CADK+QCVKKG+SYT DIVETEKS+++ GV++ A+ Sbjct: 3 STCDNCDCADKTQCVKKGSSYTADIVETEKSHVSTGVMEVPAT 45