BLASTX nr result
ID: Zingiber24_contig00000347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00000347 (526 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004493565.1| PREDICTED: outer envelope pore protein 16-3,... 62 6e-08 gb|AFK46999.1| unknown [Lotus japonicus] 61 2e-07 ref|XP_006647797.1| PREDICTED: outer envelope pore protein 16-3,... 60 4e-07 ref|XP_004136578.1| PREDICTED: outer envelope pore protein 16-3,... 58 1e-06 gb|EOY09452.1| Mitochondrial import inner membrane translocase s... 58 1e-06 ref|NP_001236744.1| uncharacterized protein LOC100499840 [Glycin... 57 3e-06 ref|XP_002331044.1| predicted protein [Populus trichocarpa] gi|5... 56 4e-06 gb|ESW34297.1| hypothetical protein PHAVU_001G140800g [Phaseolus... 56 6e-06 gb|EXC30867.1| hypothetical protein L484_028046 [Morus notabilis] 55 7e-06 ref|NP_001236363.1| uncharacterized protein LOC100527715 [Glycin... 55 7e-06 ref|XP_004953694.1| PREDICTED: outer envelope pore protein 16-3,... 55 1e-05 ref|XP_003570244.1| PREDICTED: uncharacterized protein LOC100838... 55 1e-05 >ref|XP_004493565.1| PREDICTED: outer envelope pore protein 16-3, chloroplastic/mitochondrial-like [Cicer arietinum] Length = 160 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRPN 344 +GRSI + +SAGS L FTSA+LD GG+TM+ DTGK Y TT KRP+ Sbjct: 110 RGRSIPNAISAGSALAFTSAVLDFGGQTMKHDTGKEYAAYTTKKRPS 156 >gb|AFK46999.1| unknown [Lotus japonicus] Length = 162 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRPN 344 KGRSI + +SAGS L FTSA+LD GG+TM+ D GK Y TT KRP+ Sbjct: 113 KGRSISTALSAGSALAFTSAVLDFGGQTMKHDDGKEYAAYTTKKRPS 159 >ref|XP_006647797.1| PREDICTED: outer envelope pore protein 16-3, chloroplastic/mitochondrial-like [Oryza brachyantha] Length = 150 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRP 347 +GRSIQS ++AGS L FTSA+LD+GG T R D GK Y P T K+P Sbjct: 103 RGRSIQSAIAAGSCLAFTSAVLDVGGNTTRVDNGKEYYPYTIEKKP 148 >ref|XP_004136578.1| PREDICTED: outer envelope pore protein 16-3, chloroplastic/mitochondrial-like [Cucumis sativus] gi|449501899|ref|XP_004161489.1| PREDICTED: outer envelope pore protein 16-3, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 158 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRPNV 341 KG+SI + +SAG+ L FTS+++D+GG+T R DTGK Y P TT KR ++ Sbjct: 110 KGKSISTALSAGAALAFTSSVIDIGGQTTRIDTGKEYYPYTTKKRSHI 157 >gb|EOY09452.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Theobroma cacao] Length = 159 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRP 347 KGRSI + ++AG+ L TSA++D GG+T R DTGK Y P TT KRP Sbjct: 110 KGRSISTAIAAGTALAVTSAVIDAGGQTTRIDTGKEYYPYTTKKRP 155 >ref|NP_001236744.1| uncharacterized protein LOC100499840 [Glycine max] gi|571552640|ref|XP_006603652.1| PREDICTED: uncharacterized protein LOC100499840 isoform X1 [Glycine max] gi|255627053|gb|ACU13871.1| unknown [Glycine max] Length = 160 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRPN 344 +GRSI++ +SAGS L FTSA LD G +T++ DTGK Y TT KRP+ Sbjct: 111 RGRSIKTALSAGSALAFTSAFLDFGDQTIKHDTGKEYAAYTTKKRPS 157 >ref|XP_002331044.1| predicted protein [Populus trichocarpa] gi|566174697|ref|XP_006381058.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Populus trichocarpa] gi|550335561|gb|ERP58855.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Populus trichocarpa] Length = 159 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRPNV 341 KGR+I++ ++AG+ L TSAI+D GG+T R DTGK Y P TT KR V Sbjct: 110 KGRNIKNAIAAGAALAVTSAIIDAGGQTTRMDTGKEYYPYTTKKRSAV 157 >gb|ESW34297.1| hypothetical protein PHAVU_001G140800g [Phaseolus vulgaris] gi|561035768|gb|ESW34298.1| hypothetical protein PHAVU_001G140800g [Phaseolus vulgaris] Length = 160 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKR 350 KGRSI+S +SAGS L FTSA +D GG+T++ D GK Y TT KR Sbjct: 111 KGRSIKSALSAGSALAFTSAYIDFGGQTLKHDEGKEYAAYTTKKR 155 >gb|EXC30867.1| hypothetical protein L484_028046 [Morus notabilis] Length = 160 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKR 350 KGRS+ + +SAG+ L TSA++D GG+T R DTGK Y P TT KR Sbjct: 111 KGRSLSTAISAGAALAVTSAVIDAGGQTTRIDTGKEYYPYTTKKR 155 >ref|NP_001236363.1| uncharacterized protein LOC100527715 [Glycine max] gi|571443518|ref|XP_006576208.1| PREDICTED: uncharacterized protein LOC100527715 isoform X1 [Glycine max] gi|571443520|ref|XP_006576209.1| PREDICTED: uncharacterized protein LOC100527715 isoform X2 [Glycine max] gi|255633032|gb|ACU16871.1| unknown [Glycine max] Length = 160 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRPN 344 +GRSI++ +SAGS L FTSA LD G +T++ D GK Y TT KRP+ Sbjct: 111 RGRSIKTALSAGSALAFTSAFLDFGDQTLKHDAGKEYAAYTTKKRPS 157 >ref|XP_004953694.1| PREDICTED: outer envelope pore protein 16-3, chloroplastic/mitochondrial-like [Setaria italica] Length = 148 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRP 347 +G+SIQS + GS L FTSAILD+GG T R D GK Y TT K+P Sbjct: 101 RGKSIQSALIGGSCLAFTSAILDIGGNTTRVDNGKEYYAYTTEKKP 146 >ref|XP_003570244.1| PREDICTED: uncharacterized protein LOC100838295 isoform 1 [Brachypodium distachyon] gi|357137313|ref|XP_003570245.1| PREDICTED: uncharacterized protein LOC100838295 isoform 2 [Brachypodium distachyon] Length = 148 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -1 Query: 484 KGRSIQSGVSAGSILGFTSAILDLGGRTMRQDTGKVYDPVTTIKRP 347 +GRSI+S + GS L FTSA+LD+GG T R D GK Y TT K+P Sbjct: 101 RGRSIKSALIGGSSLAFTSAVLDVGGNTTRVDNGKAYHAYTTEKKP 146