BLASTX nr result
ID: Zingiber24_contig00000075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00000075 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK18562.1| actin [Eustoma exaltatum subsp. russellianum] gi... 73 3e-11 sp|P30161.2|ACT_COSCS RecName: Full=Actin gi|17957|emb|CAA42560.... 72 8e-11 gb|AHA91825.1| actin-1, partial [Rosa hybrid cultivar] 72 8e-11 ref|XP_006846523.1| hypothetical protein AMTR_s00018p00188200 [A... 72 8e-11 gb|EOY23776.1| Actin 7 isoform 1 [Theobroma cacao] gi|508776521|... 72 8e-11 gb|EON96074.1| putative actin protein [Togninia minima UCRPA7] 72 8e-11 ref|XP_006297921.1| hypothetical protein CARUB_v10013962mg [Caps... 72 8e-11 gb|AFZ78529.1| actin [Populus tomentosa] 72 8e-11 gb|AFZ78528.1| actin [Populus tomentosa] 72 8e-11 gb|AAW56950.1| actin, partial [Mallomonas rasilis] 72 8e-11 gb|AAF71266.1|AF246716_1 actin-like protein [Phalaenopsis hybrid... 72 8e-11 gb|ABB02445.1| actin [Saccharina japonica] gi|82502191|gb|ABB801... 72 8e-11 gb|AAU94674.1| actin [Stramenopile sp. ex Nuclearia delicatula C... 72 8e-11 dbj|BAD29952.1| beta-actin [Ulva pertusa] gi|50355625|dbj|BAD299... 72 8e-11 sp|P53502.1|ACT_FUCDI RecName: Full=Actin gi|511470|gb|AAA19858.... 72 8e-11 sp|Q39758.1|ACT_FUCVE RecName: Full=Actin gi|1419540|emb|CAA6738... 72 8e-11 gb|AFO68183.1| actin, partial [Anthurium andraeanum] 72 8e-11 gb|AFO65511.1| actin 2 [Narcissus tazetta] 72 8e-11 gb|AFK41203.1| unknown [Medicago truncatula] 72 8e-11 gb|AEW46681.1| actin [Ulva linza] 72 8e-11 >dbj|BAK18562.1| actin [Eustoma exaltatum subsp. russellianum] gi|327492445|dbj|BAK18563.1| actin [Eustoma exaltatum subsp. russellianum] Length = 332 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF Sbjct: 299 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 332 >sp|P30161.2|ACT_COSCS RecName: Full=Actin gi|17957|emb|CAA42560.1| actin [Costaria costata] Length = 331 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 298 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 331 >gb|AHA91825.1| actin-1, partial [Rosa hybrid cultivar] Length = 84 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 51 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 84 >ref|XP_006846523.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda] gi|548849333|gb|ERN08198.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWI+KAEYEESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWIAKAEYEESGPSIVHRKCF 377 >gb|EOY23776.1| Actin 7 isoform 1 [Theobroma cacao] gi|508776521|gb|EOY23777.1| Actin 7 isoform 1 [Theobroma cacao] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 377 >gb|EON96074.1| putative actin protein [Togninia minima UCRPA7] Length = 198 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 165 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 198 >ref|XP_006297921.1| hypothetical protein CARUB_v10013962mg [Capsella rubella] gi|482566630|gb|EOA30819.1| hypothetical protein CARUB_v10013962mg [Capsella rubella] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 377 >gb|AFZ78529.1| actin [Populus tomentosa] Length = 231 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 198 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 231 >gb|AFZ78528.1| actin [Populus tomentosa] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 377 >gb|AAW56950.1| actin, partial [Mallomonas rasilis] Length = 297 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 264 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 297 >gb|AAF71266.1|AF246716_1 actin-like protein [Phalaenopsis hybrid cultivar] Length = 214 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 181 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 214 >gb|ABB02445.1| actin [Saccharina japonica] gi|82502191|gb|ABB80121.1| actin [Saccharina japonica] gi|210061710|gb|ACJ05913.1| beta-actin [Saccharina japonica] gi|298708477|emb|CBJ30601.1| actin [Ectocarpus siliculosus] Length = 376 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 343 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 376 >gb|AAU94674.1| actin [Stramenopile sp. ex Nuclearia delicatula CCAP1552/1] Length = 303 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 268 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 301 >dbj|BAD29952.1| beta-actin [Ulva pertusa] gi|50355625|dbj|BAD29953.1| actin [Ulva pertusa] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 377 >sp|P53502.1|ACT_FUCDI RecName: Full=Actin gi|511470|gb|AAA19858.1| actin [Fucus distichus] gi|1096521|prf||2111439A actin Length = 375 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 342 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 375 >sp|Q39758.1|ACT_FUCVE RecName: Full=Actin gi|1419540|emb|CAA67388.1| beta-actin [Fucus vesiculosus] Length = 376 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 343 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 376 >gb|AFO68183.1| actin, partial [Anthurium andraeanum] Length = 276 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 243 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 276 >gb|AFO65511.1| actin 2 [Narcissus tazetta] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 377 >gb|AFK41203.1| unknown [Medicago truncatula] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWI+KAEYEESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWIAKAEYEESGPSIVHRKCF 377 >gb|AEW46681.1| actin [Ulva linza] Length = 377 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 285 GGSILASLSTFQQMWISKAEYEESGPSIVHRKCF 184 GGSILASLSTFQQMWISKAEY+ESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 377