BLASTX nr result
ID: Zingiber23_contig00054907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054907 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513321.1| conserved hypothetical protein [Ricinus comm... 62 8e-08 ref|XP_006465185.1| PREDICTED: mediator of RNA polymerase II tra... 59 5e-07 >ref|XP_002513321.1| conserved hypothetical protein [Ricinus communis] gi|223547229|gb|EEF48724.1| conserved hypothetical protein [Ricinus communis] Length = 549 Score = 62.0 bits (149), Expect = 8e-08 Identities = 38/90 (42%), Positives = 45/90 (50%), Gaps = 2/90 (2%) Frame = +1 Query: 1 ANSPRSDPNIMNTPSPXXXXXXXXXXXX--KIMXXXXXXXXXXXXXXXXSSITGVLGQRS 174 ANSPRS N+MNTPSP KIM SS+ G LGQ Sbjct: 298 ANSPRSGTNMMNTPSPQQQTQQQQQQQQRQKIMQLPQHQQQLLAQQLRQSSMQG-LGQNQ 356 Query: 175 ISQLHDITGQTQQKLQQIAGQHQMSYSHPM 264 + QLHD+ GQ QQK Q + GQHQM +S + Sbjct: 357 LPQLHDLQGQGQQKFQPLHGQHQMQFSQSL 386 >ref|XP_006465185.1| PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Citrus sinensis] gi|568821443|ref|XP_006465186.1| PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Citrus sinensis] Length = 563 Score = 59.3 bits (142), Expect = 5e-07 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 7/95 (7%) Frame = +1 Query: 1 ANSPRSDPNIMNTPSPXXXXXXXXXXXX-------KIMXXXXXXXXXXXXXXXXSSITGV 159 ANSPRS N+MNTPSP K+M S + G Sbjct: 312 ANSPRSGTNMMNTPSPQQQQQQQQQQQQQQQQQRQKMMQLPHQQQLLAQQQFRQSQMQG- 370 Query: 160 LGQRSISQLHDITGQTQQKLQQIAGQHQMSYSHPM 264 LGQ +SQLHD+ GQ QK QQ+ GQHQM +S PM Sbjct: 371 LGQNQMSQLHDLQGQ--QKFQQLHGQHQMQFSQPM 403