BLASTX nr result
ID: Zingiber23_contig00054885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054885 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844678.1| hypothetical protein AMTR_s00016p00243730 [A... 56 6e-06 ref|XP_002321064.1| hypothetical protein POPTR_0014s13600g [Popu... 55 7e-06 >ref|XP_006844678.1| hypothetical protein AMTR_s00016p00243730 [Amborella trichopoda] gi|548847149|gb|ERN06353.1| hypothetical protein AMTR_s00016p00243730 [Amborella trichopoda] Length = 208 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 360 VDDEAEEFIKRFYEQLRVQSRMALLHYQEKEFQETLAR 247 VD EAEEFIKRFYE+LRVQSR A L Y+E E++E L R Sbjct: 168 VDAEAEEFIKRFYEELRVQSRTARLEYREMEYREMLVR 205 >ref|XP_002321064.1| hypothetical protein POPTR_0014s13600g [Populus trichocarpa] gi|118485866|gb|ABK94780.1| unknown [Populus trichocarpa] gi|222861837|gb|EEE99379.1| hypothetical protein POPTR_0014s13600g [Populus trichocarpa] Length = 211 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 363 KVDDEAEEFIKRFYEQLRVQSRMALLHYQE 274 +VDDEAEEFI+RFYEQLRVQSRM LL YQE Sbjct: 181 QVDDEAEEFIRRFYEQLRVQSRMQLLQYQE 210