BLASTX nr result
ID: Zingiber23_contig00054862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054862 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002110123.1| hypothetical protein TRIADDRAFT_21658 [Trich... 55 7e-06 >ref|XP_002110123.1| hypothetical protein TRIADDRAFT_21658 [Trichoplax adhaerens] gi|190588247|gb|EDV28289.1| hypothetical protein TRIADDRAFT_21658, partial [Trichoplax adhaerens] Length = 1039 Score = 55.5 bits (132), Expect = 7e-06 Identities = 20/41 (48%), Positives = 31/41 (75%) Frame = +2 Query: 2 VKHLFSSKSASWGFTKFLSWKEVQDPSRGFLLNETLIIEAS 124 + H+F K WGF++F+SW + DPS+GF+ N+T+I+EAS Sbjct: 94 IHHVFFPKENDWGFSQFISWNDTMDPSKGFIKNDTIILEAS 134