BLASTX nr result
ID: Zingiber23_contig00054666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054666 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006393100.1| hypothetical protein EUTSA_v10011243mg [Eutr... 56 6e-06 >ref|XP_006393100.1| hypothetical protein EUTSA_v10011243mg [Eutrema salsugineum] gi|557089678|gb|ESQ30386.1| hypothetical protein EUTSA_v10011243mg [Eutrema salsugineum] Length = 824 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 7/66 (10%) Frame = -2 Query: 277 LIADETSATIAALE------VKPVRDSVTEALQIWMNITGHRENSTSGNAKD-SKNPDIS 119 L+AD+T +T+ ALE +KPVR+S++EAL +W NITG E+ TS + KD S I Sbjct: 284 LVADKTDSTLTALEAFRFDKIKPVRESLSEALNVWKNITGKGESGTSDDQKDVSSEQCIL 343 Query: 118 DKDGTT 101 +++G T Sbjct: 344 ERNGET 349