BLASTX nr result
ID: Zingiber23_contig00054570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054570 (211 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004953461.1| PREDICTED: protein TRANSPARENT TESTA GLABRA ... 57 3e-06 gb|EXB78377.1| Protein TRANSPARENT TESTA GLABRA 1 [Morus notabilis] 56 6e-06 gb|AAM76742.1| anthocyanin biosynthetic gene regulator PAC1 [Zea... 56 6e-06 gb|AFN17366.1| Tan1 [Sorghum bicolor] 56 6e-06 gb|AGL81358.1| WD40 repeat protein [Pyrus communis] 55 1e-05 gb|ABQ18246.1| transcription factor WD-repeat protein 1 [Caragan... 55 1e-05 >ref|XP_004953461.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Setaria italica] Length = 359 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 3 AGAEINQLQWSSAHPDWISIAFANQVKLLRL 95 AGAEINQLQWS+AHPDW++IAF N+V+LLR+ Sbjct: 329 AGAEINQLQWSAAHPDWMAIAFENKVQLLRV 359 >gb|EXB78377.1| Protein TRANSPARENT TESTA GLABRA 1 [Morus notabilis] Length = 340 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 3 AGAEINQLQWSSAHPDWISIAFANQVKLLRL 95 AGAEINQLQWS+A PDWISIAFAN+++LL++ Sbjct: 310 AGAEINQLQWSAAQPDWISIAFANKMQLLKV 340 >gb|AAM76742.1| anthocyanin biosynthetic gene regulator PAC1 [Zea mays] gi|413938265|gb|AFW72816.1| pale aleurone color1 [Zea mays] Length = 353 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 AGAEINQLQWSSAHPDWISIAFANQVKLLRL 95 AGAEINQLQW++AHPDW++IAF N+V+LLR+ Sbjct: 323 AGAEINQLQWAAAHPDWMAIAFENKVQLLRV 353 >gb|AFN17366.1| Tan1 [Sorghum bicolor] Length = 353 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 AGAEINQLQWSSAHPDWISIAFANQVKLLRL 95 AGAEINQLQW++AHPDW++IAF N+V+LLR+ Sbjct: 323 AGAEINQLQWAAAHPDWMAIAFENKVQLLRV 353 >gb|AGL81358.1| WD40 repeat protein [Pyrus communis] Length = 342 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 AGAEINQLQWSSAHPDWISIAFANQVKLLRL 95 AGAEINQLQWS+A PDWISIAF+N+++LL++ Sbjct: 312 AGAEINQLQWSAAQPDWISIAFSNKMRLLKV 342 >gb|ABQ18246.1| transcription factor WD-repeat protein 1 [Caragana jubata] Length = 337 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +3 Query: 3 AGAEINQLQWSSAHPDWISIAFANQVKLLRL 95 AG EINQLQW +AHPDWI++AFAN+++LLR+ Sbjct: 307 AGCEINQLQWPAAHPDWIAVAFANKMQLLRV 337