BLASTX nr result
ID: Zingiber23_contig00054419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054419 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 73 5e-11 ref|XP_003588412.1| Ribosomal protein S10 [Medicago truncatula] ... 64 2e-08 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 72.8 bits (177), Expect = 5e-11 Identities = 41/60 (68%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = -3 Query: 232 RSPF-LAAMGSTCEQGKPNGMGTKKGEGTALGRRRSKKRRLTLGEIGDR*LASKPARPQG 56 RSPF LAAMGSTC+QGKPNG ++G LGRRRSKKRRLTL + LASKPARP+G Sbjct: 986 RSPFFLAAMGSTCKQGKPNGNQKREGTTLTLGRRRSKKRRLTLLK-----LASKPARPRG 1040 >ref|XP_003588412.1| Ribosomal protein S10 [Medicago truncatula] gi|355477460|gb|AES58663.1| Ribosomal protein S10 [Medicago truncatula] Length = 159 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -3 Query: 211 MGSTCEQGKPNGMGTKKGEGTALGRRRSKKRRLTLGEIGDR*LASKPARPQG 56 MGSTC+QGKPNG ++G LGRRRSKKRRLTL + LASKPARP+G Sbjct: 1 MGSTCKQGKPNGNQKREGTTLTLGRRRSKKRRLTLLK-----LASKPARPRG 47