BLASTX nr result
ID: Zingiber23_contig00054329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054329 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002445157.1| hypothetical protein SORBIDRAFT_07g005000 [S... 55 7e-06 >ref|XP_002445157.1| hypothetical protein SORBIDRAFT_07g005000 [Sorghum bicolor] gi|241941507|gb|EES14652.1| hypothetical protein SORBIDRAFT_07g005000 [Sorghum bicolor] Length = 368 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 5/56 (8%) Frame = +3 Query: 15 GWTDAGT*SLEEWD-----LAFVLRKTGRPSSIRRNSSTNKGKMYIMEDDIEFFSI 167 G D T S +EW+ LAFVLRK G+PS+ +R ++TNKGKM++ E DIEF I Sbjct: 313 GRQDQSTLSQDEWEVSYLYLAFVLRKRGQPSTQQRANNTNKGKMFLTEGDIEFLGI 368