BLASTX nr result
ID: Zingiber23_contig00054293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054293 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579190.1| PREDICTED: F-box/LRR-repeat protein 17-like ... 56 6e-06 ref|XP_003562226.1| PREDICTED: F-box/LRR-repeat protein 17-like ... 56 6e-06 ref|XP_003562225.1| PREDICTED: F-box/LRR-repeat protein 17-like ... 56 6e-06 >ref|XP_003579190.1| PREDICTED: F-box/LRR-repeat protein 17-like [Brachypodium distachyon] Length = 608 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/70 (41%), Positives = 36/70 (51%), Gaps = 13/70 (18%) Frame = +2 Query: 119 HPTAATPAQAI-------------RSRGSYSCGRCGLPKKGHICPDGGGPVSAPXXXXXX 259 HP A P + ++RGSY+CGRCG+PKKGH+CP G P A Sbjct: 14 HPVAVAPPETSDAAAAALLRVEKKKARGSYNCGRCGMPKKGHVCPIPGPP--AAGSALPP 71 Query: 260 XXALSFDVDP 289 ALSFD +P Sbjct: 72 RRALSFDEEP 81 >ref|XP_003562226.1| PREDICTED: F-box/LRR-repeat protein 17-like isoform 2 [Brachypodium distachyon] Length = 538 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 5/45 (11%) Frame = +2 Query: 122 PTAATPAQAIRSRGSYSCGRCGLPKKGHIC-----PDGGGPVSAP 241 PT P ++RGSY+CGRCGLPKKGH+C DGG P +P Sbjct: 5 PTKPPPPPRPKTRGSYNCGRCGLPKKGHVCNLPSPADGGAPTPSP 49 >ref|XP_003562225.1| PREDICTED: F-box/LRR-repeat protein 17-like isoform 1 [Brachypodium distachyon] Length = 575 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 5/45 (11%) Frame = +2 Query: 122 PTAATPAQAIRSRGSYSCGRCGLPKKGHIC-----PDGGGPVSAP 241 PT P ++RGSY+CGRCGLPKKGH+C DGG P +P Sbjct: 5 PTKPPPPPRPKTRGSYNCGRCGLPKKGHVCNLPSPADGGAPTPSP 49