BLASTX nr result
ID: Zingiber23_contig00054117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00054117 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33547.1| NADH dehydrogenase [ubiquinone] iron-sulfur prote... 64 3e-08 gb|AGC79019.1| hypothetical protein (mitochondrion) [Vicia faba]... 64 3e-08 tpg|DAA42763.1| TPA: hypothetical protein ZEAMMB73_123667 [Zea m... 63 5e-08 ref|XP_002535139.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 gb|EXC13351.1| NADH dehydrogenase [ubiquinone] iron-sulfur prote... 59 5e-07 >gb|EXC33547.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus notabilis] Length = 402 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 GSVRSGASGFQCTASKIRTSLPADHCRPIL 92 GSVR GASGFQCTASKIRTSLPADHCRPIL Sbjct: 244 GSVRGGASGFQCTASKIRTSLPADHCRPIL 273 >gb|AGC79019.1| hypothetical protein (mitochondrion) [Vicia faba] gi|443267195|gb|AGC79350.1| hypothetical protein (mitochondrion) [Vicia faba] gi|443267197|gb|AGC79352.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 126 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 GSVRSGASGFQCTASKIRTSLPADHCRPIL 92 GSVR GASGFQCTASKIRTSLPADHCRPIL Sbjct: 96 GSVRGGASGFQCTASKIRTSLPADHCRPIL 125 >tpg|DAA42763.1| TPA: hypothetical protein ZEAMMB73_123667 [Zea mays] Length = 60 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 88 MGRQWSAGKLVLILDAVHWNPEAPLRTLP 2 MGRQWSAGKLVLILDAVHWNPEAP RTLP Sbjct: 1 MGRQWSAGKLVLILDAVHWNPEAPPRTLP 29 >ref|XP_002535139.1| conserved hypothetical protein [Ricinus communis] gi|223523944|gb|EEF27245.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 88 MGRQWSAGKLVLILDAVHWNPEAPLRTLP 2 MGRQWS GKLVLILDAVHWNPEAP RTLP Sbjct: 1 MGRQWSTGKLVLILDAVHWNPEAPPRTLP 29 >gb|EXC13351.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus notabilis] Length = 275 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 3 GSVRSGASGFQCTASKIRTSLPADHCRPIL 92 GSVR GASGFQCTASKIRTSLPADH RPIL Sbjct: 245 GSVRGGASGFQCTASKIRTSLPADHYRPIL 274