BLASTX nr result
ID: Zingiber23_contig00053976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053976 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ93020.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 4e-06 dbj|BAJ88203.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 4e-06 gb|EMJ05429.1| hypothetical protein PRUPE_ppa002657mg [Prunus pe... 55 7e-06 >dbj|BAJ93020.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 550 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 2 RRDFAQAHSLYLRSLRATGAALLQFANAETYNHNNNDHHH 121 RRD A AH+LYLRSLRATGAALLQFA AE N + + H H Sbjct: 31 RRDMAAAHALYLRSLRATGAALLQFATAEADNPHPHPHTH 70 >dbj|BAJ88203.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 668 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 2 RRDFAQAHSLYLRSLRATGAALLQFANAETYNHNNNDHHH 121 RRD A AH+LYLRSLRATGAALLQFA AE N + + H H Sbjct: 31 RRDMAAAHALYLRSLRATGAALLQFATAEADNPHPHPHTH 70 >gb|EMJ05429.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica] Length = 647 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/42 (61%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = +2 Query: 2 RRDFAQAHSLYLRSLRATGAALLQFANAET--YNHNNNDHHH 121 R+ ++ AH++YLRSLR+TGAALLQF+NAET ++HNN+ HH Sbjct: 31 RQAWSAAHTMYLRSLRSTGAALLQFSNAETTVHHHNNHYSHH 72