BLASTX nr result
ID: Zingiber23_contig00053805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053805 (221 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ41268.1| NADPH-P450 reductase 1 [Zingiber officinale] 103 2e-20 >dbj|BAJ41268.1| NADPH-P450 reductase 1 [Zingiber officinale] Length = 703 Score = 103 bits (257), Expect = 2e-20 Identities = 51/61 (83%), Positives = 54/61 (88%) Frame = -2 Query: 184 DVSSLDLMADILKAKLDASELLQWASKLYENPRFLEVAVLVGCLAAFLLFWQRSGNKEPA 5 DVS+ DLMA IL KLDAS LLQWASKL ENPRFLEVAVLVGCL+AFLLFWQ+SG KEPA Sbjct: 5 DVSTTDLMAAILNGKLDASNLLQWASKLSENPRFLEVAVLVGCLSAFLLFWQKSGGKEPA 64 Query: 4 R 2 R Sbjct: 65 R 65