BLASTX nr result
ID: Zingiber23_contig00053776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053776 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69966.1| hypothetical protein VITISV_039411 [Vitis vinifera] 53 2e-06 >emb|CAN69966.1| hypothetical protein VITISV_039411 [Vitis vinifera] Length = 825 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = +2 Query: 143 SSHP--GRVDGDKWQTPLKVYKRR-NKNSKTPLLIWHVLGDDKPAWEII 280 SS P GRVD DKWQ PLKVY+RR +SK LIWH L D+ +W +I Sbjct: 777 SSFPRSGRVDRDKWQPPLKVYQRRKGVDSKAQALIWHSLDDNGLSWNLI 825 Score = 24.3 bits (51), Expect(2) = 2e-06 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 93 NNVIQERFHAFNSPKTSLLTQGEL 164 N ERFH FNS ++S G + Sbjct: 762 NQDFYERFHVFNSSRSSFPRSGRV 785