BLASTX nr result
ID: Zingiber23_contig00053583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053583 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY07330.1| DNA double-strand break repair rad50 ATPase, puta... 55 7e-06 gb|EOY07329.1| DNA double-strand break repair rad50 ATPase, puta... 55 7e-06 >gb|EOY07330.1| DNA double-strand break repair rad50 ATPase, putative isoform 2 [Theobroma cacao] Length = 515 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 98 MVKHGNSRHKKPDNLGKGKVTPVQIAFIVDRYLAANRFDAT 220 M K G S+ KP+NLGKGKVTPVQ+AFIVDRYL+ N + T Sbjct: 1 MGKQGRSK-AKPENLGKGKVTPVQVAFIVDRYLSDNNYPGT 40 >gb|EOY07329.1| DNA double-strand break repair rad50 ATPase, putative isoform 1 [Theobroma cacao] Length = 515 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 98 MVKHGNSRHKKPDNLGKGKVTPVQIAFIVDRYLAANRFDAT 220 M K G S+ KP+NLGKGKVTPVQ+AFIVDRYL+ N + T Sbjct: 1 MGKQGRSK-AKPENLGKGKVTPVQVAFIVDRYLSDNNYPGT 40