BLASTX nr result
ID: Zingiber23_contig00053532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053532 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006295170.1| hypothetical protein CARUB_v10024250mg [Caps... 59 7e-07 ref|XP_002880643.1| hypothetical protein ARALYDRAFT_481350 [Arab... 59 7e-07 ref|XP_002515394.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|NP_565581.1| uncharacterized protein [Arabidopsis thaliana] ... 58 1e-06 >ref|XP_006295170.1| hypothetical protein CARUB_v10024250mg [Capsella rubella] gi|482563878|gb|EOA28068.1| hypothetical protein CARUB_v10024250mg [Capsella rubella] Length = 151 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +1 Query: 232 HHHHPAVDDVMKVLSKASQELILVQCQLDQEFQQSYPDGVNPCK 363 HHHH AVD+++ VL++AS +L LV +LD+EFQQ YP+ NP K Sbjct: 3 HHHHQAVDNLVNVLARASHDLNLVHSKLDKEFQQIYPENANPMK 46 >ref|XP_002880643.1| hypothetical protein ARALYDRAFT_481350 [Arabidopsis lyrata subsp. lyrata] gi|297326482|gb|EFH56902.1| hypothetical protein ARALYDRAFT_481350 [Arabidopsis lyrata subsp. lyrata] Length = 152 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +1 Query: 229 HHHHHPAVDDVMKVLSKASQELILVQCQLDQEFQQSYPDGVNPCK 363 H+HHH AVD+++ V ++AS +L +V +LD+EFQQ YPD NP K Sbjct: 3 HNHHHQAVDNLINVFARASHDLTVVHSKLDKEFQQLYPDNANPMK 47 >ref|XP_002515394.1| conserved hypothetical protein [Ricinus communis] gi|223545338|gb|EEF46843.1| conserved hypothetical protein [Ricinus communis] Length = 152 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +1 Query: 232 HHHHPAVDDVMKVLSKASQELILVQCQLDQEFQQSYPDGVNPCK 363 HH H A D+V+ +L KA+ +LILVQ +L++EFQQ YPD NP K Sbjct: 3 HHSHQAADNVVNLLKKANHDLILVQLKLEKEFQQVYPDNANPMK 46 >ref|NP_565581.1| uncharacterized protein [Arabidopsis thaliana] gi|4559355|gb|AAD23016.1| expressed protein [Arabidopsis thaliana] gi|21536662|gb|AAM60994.1| unknown [Arabidopsis thaliana] gi|88900396|gb|ABD57510.1| At2g24970 [Arabidopsis thaliana] gi|330252551|gb|AEC07645.1| uncharacterized protein AT2G24970 [Arabidopsis thaliana] Length = 152 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +1 Query: 229 HHHHHPAVDDVMKVLSKASQELILVQCQLDQEFQQSYPDGVNPCK 363 H+HHH AVD+++ V S+AS +L +V +LD+EFQQ YP NP K Sbjct: 3 HNHHHQAVDNLLNVFSRASHDLTVVHSKLDKEFQQMYPANANPMK 47