BLASTX nr result
ID: Zingiber23_contig00052982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052982 (480 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR96011.1| hypothetical protein [Musa acuminata] 60 4e-07 >gb|AAR96011.1| hypothetical protein [Musa acuminata] Length = 1382 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/60 (55%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +3 Query: 303 DDLPLTDYEGGGSPIPNDPFGLFFLMNFDGYSEACSP-TIVDQIVSTLSFPAAQQESGLW 479 D D GSPIP DPF L L+NFD Y E+CSP TIVDQI T+SF QQ G+W Sbjct: 415 DGFATADCGWSGSPIPCDPFALSELVNFDDYIESCSPATIVDQIF-TMSFSIVQQTPGVW 473